KEGG   Ovis aries (sheep): 101116856
Entry
101116856         CDS       T03117                                 

Gene name
ERCC1
Definition
(RefSeq) DNA excision repair protein ERCC-1 isoform X1
  KO
K10849  DNA excision repair protein ERCC-1
Organism
oas  Ovis aries (sheep)
Pathway
oas01524  Platinum drug resistance
oas03420  Nucleotide excision repair
oas03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    101116856 (ERCC1)
   03460 Fanconi anemia pathway
    101116856 (ERCC1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101116856 (ERCC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:oas03400]
    101116856 (ERCC1)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     101116856 (ERCC1)
SSDB
Motif
Pfam: Rad10 HHH_5 HHH_2 HHH
Other DBs
NCBI-GeneID: 101116856
NCBI-ProteinID: XP_027834285
LinkDB
Position
14
AA seq 306 aa
MESVDRPQEELAMDEEGGPKPAGPPTRKKFLIPMDEDVVPPPGAKPLFRSTRSLPTVETS
PPPGPQTYAEYALSGPPGGAEATRPVGPEPLAGETPNQAPKPGAKSNSIIVSPRQRGNPV
LRFVRNVPWEFGDVLPDYVLGQSTCALFLSLRYHNLHPDYIHQRLQSLGKSYALRVLLVQ
VDVKDPQKALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFV
SRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLSLCPGLGPQKARRLFDVFHEP
FLKVPH
NT seq 921 nt   +upstreamnt  +downstreamnt
atggagagtgtggaccggccccaggaggagcttgcgatggacgaagagggaggacccaag
cccgctggcccacccacaaggaagaaattcctcattcctatggacgaggatgtggtccct
cctcctggggccaagcctttattcagatccacacggagcctgcccaccgtggagacctca
cccccgccaggccctcagacctatgctgagtatgccctctctggacctccaggtggggct
gaagccacacgcccggtggggccagaacccctggcaggagagacccccaaccaggccccc
aaaccaggagcaaaatccaatagcatcattgtgagcccccggcagaggggcaaccccgtg
ctgaggttcgtgcgcaacgtgccctgggagtttggggatgtgctccccgactacgtgctg
ggccagagcacctgtgccctcttcctcagcctccgctaccacaacctccacccagactac
atccaccagcggctacagagcctgggaaagagctatgccctgcgggtcctgctcgtccag
gtggatgtgaaagatcctcagaaggccctcaaggagctggctaagatgtgcatcctggcc
gactgcaccctgatccttgcctggagccccgaggaggccggacggtacctggagacttac
aaggcctacgagcagaagccggccgatctcctgatggagaagctggagcaggacttcgtt
tcccgggtgactgaatgtctgaccaccgtcaagtcagtcaacaaaacggacagtcagacc
ctcctgactacttttgggtctctggaacagctcatagctgcatcccgggaagatctgtcc
ttgtgcccaggtctgggaccccagaaggcccgaaggctgtttgatgtcttccacgagccc
ttcttgaaagtgccccactga

DBGET integrated database retrieval system