KEGG   Ovis aries (sheep): 101117211
Entry
101117211         CDS       T03117                                 

Gene name
PDPK1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas01524  Platinum drug resistance
oas03320  PPAR signaling pathway
oas04068  FoxO signaling pathway
oas04071  Sphingolipid signaling pathway
oas04140  Autophagy - animal
oas04150  mTOR signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04152  AMPK signaling pathway
oas04210  Apoptosis
oas04510  Focal adhesion
oas04660  T cell receptor signaling pathway
oas04664  Fc epsilon RI signaling pathway
oas04722  Neurotrophin signaling pathway
oas04910  Insulin signaling pathway
oas04919  Thyroid hormone signaling pathway
oas04931  Insulin resistance
oas04960  Aldosterone-regulated sodium reabsorption
oas05145  Toxoplasmosis
oas05205  Proteoglycans in cancer
oas05213  Endometrial cancer
oas05215  Prostate cancer
oas05223  Non-small cell lung cancer
oas05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101117211 (PDPK1)
   04071 Sphingolipid signaling pathway
    101117211 (PDPK1)
   04151 PI3K-Akt signaling pathway
    101117211 (PDPK1)
   04152 AMPK signaling pathway
    101117211 (PDPK1)
   04150 mTOR signaling pathway
    101117211 (PDPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101117211 (PDPK1)
  09143 Cell growth and death
   04210 Apoptosis
    101117211 (PDPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101117211 (PDPK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101117211 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    101117211 (PDPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101117211 (PDPK1)
   03320 PPAR signaling pathway
    101117211 (PDPK1)
   04919 Thyroid hormone signaling pathway
    101117211 (PDPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101117211 (PDPK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101117211 (PDPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101117211 (PDPK1)
   05231 Choline metabolism in cancer
    101117211 (PDPK1)
  09162 Cancer: specific types
   05215 Prostate cancer
    101117211 (PDPK1)
   05213 Endometrial cancer
    101117211 (PDPK1)
   05223 Non-small cell lung cancer
    101117211 (PDPK1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101117211 (PDPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101117211 (PDPK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101117211 (PDPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    101117211 (PDPK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oas04131]
    101117211 (PDPK1)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101117211 (PDPK1)
Protein kinases [BR:oas01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   101117211 (PDPK1)
Membrane trafficking [BR:oas04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    101117211 (PDPK1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH FTA2 Kdo RIO1
Other DBs
NCBI-GeneID: 101117211
NCBI-ProteinID: XP_027817566
UniProt: A0A6P7DFT1
LinkDB
Position
24
AA seq 557 aa
MARTTSQLYDTVPIQSSVVLCSCPSPSMVRTQTEPSTAPGVPSGGSRQGPAMDGTAAQPR
ASASALQHTAQPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHII
KENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDE
TCTRFYTAEMVSALEYLHGKGIVHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARA
NSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEY
DFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESITWEDLHHQTPPKLT
AYLPAMSEDDEDCYGNYDNLLSQFGCMQVSASSSSHSLSSVDVGLPQRAGSNIEQYIHDL
DTNSFELDLQFSEDEKRLLLEKQASGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLT
EGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKI
QEVWRHRYQSHPDAAVQ
NT seq 1674 nt   +upstreamnt  +downstreamnt
atggccaggaccaccagccagctgtatgacacggttcccattcagtccagcgtggtgtta
tgctcctgcccatccccatcaatggtgaggacccagactgagcccagcacggcccccggc
gttcccagcgggggaagcaggcagggccccgccatggacggcaccgcggcccagccccgg
gcgagcgccagcgctctgcagcacaccgcgcagcccccgcagcctcggaagaaacggccc
gaggacttcaaatttggaaagattctcggtgaaggctccttttcaacagttgtcctggcc
cgagaactggcaacctcaagggaatatgctattaaaattctagagaaacgccacattatc
aaagagaacaaagtcccgtatgtaaccagagagcgagatgtgatgtcgcggctggatcat
cccttctttgttaaactttacttcacatttcaggatgatgaaaagctgtattttggcctt
agttatgccaaaaacggagaactgcttaaatacattcggaaaatcggttcattcgatgag
acgtgcacccgcttttacacggccgagatggtgtctgctctggagtacttgcacggcaag
ggcatcgtccacagggacctgaaaccagaaaatattttgttaaatgaagacatgcacatc
cagatcacagattttggaacagcaaaagtattgtccccagagagtaaacaagccagggcc
aactcgtttgtgggaacagcccagtatgtctctccagagctgctcacagagaaatcggcc
tgtaagagctcagacctttgggcactcggatgcatcatataccagcttgtggcaggactg
cctccgttccgagctggaaatgagtatcttatatttcagaagatcattaaattggagtat
gacttccctgaaaaattctttcctaaggcgagagaccttgtggagaaacttctggtttta
gatgccacaaagagattaggctgtgaagaaatggaggggtatggccctctgaaagcccac
ccattctttgagtccatcacgtgggaggacctgcatcaccagacacccccgaagcttaca
gcttacttgccggccatgtcggaagacgacgaggactgctatggcaactacgacaatctc
ctgagccagttcggctgcatgcaggtgtcggcgtcctcctcctcgcactccctgtcgtct
gtggacgtaggcctgccccagcgggcgggcagcaacatcgagcagtacatccacgacctg
gacacgaactcctttgaactggacttacagttttctgaagacgagaagagattgttgttg
gagaagcaggccagcggaaacccttggcaccagtttgtagaaaataatttaatactaaaa
atgggtccagtagacaagcggaagggtttatttgcacggcgacgacagttgctgctcacg
gaagggccacatttgtattatgtggatcctgtcaacaaagtcttgaaaggtgaaattcca
tggtcacaagaactccgaccagaggccaagaattttaaaaccttctttgtgcacacgcca
aacaggacatattacctgatggaccccagcgggaacgcgcataagtggtgccgaaagata
caggaggtgtggcggcacaggtaccagagccacccggatgccgccgtgcagtga

DBGET integrated database retrieval system