KEGG   Ovis aries (sheep): 101117393Help
Entry
101117393         CDS       T03117                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
oas  Ovis aries (sheep)
Pathway
oas00250  Alanine, aspartate and glutamate metabolism
oas00410  beta-Alanine metabolism
oas00430  Taurine and hypotaurine metabolism
oas00650  Butanoate metabolism
oas01100  Metabolic pathways
oas04727  GABAergic synapse
oas04940  Type I diabetes mellitus
Module
oas_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    101117393 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101117393 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101117393 (GAD1)
   00430 Taurine and hypotaurine metabolism
    101117393 (GAD1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    101117393 (GAD1)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    101117393 (GAD1)
Enzymes [BR:oas01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     101117393 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS DegT_DnrJ_EryC1 OKR_DC_1 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 101117393
NCBI-ProteinID: XP_004004656
Ensembl: ENSOARG00000002329
LinkDB All DBs
Position
2
AA seq 594 aa AA seqDB search
MASSTPSSSATSSNAGVDPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCENSDKDGRFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARFKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADLETKILEAKQKGYVPLYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSQKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQV
NKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGVPDSPERREKLHRVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcgaccccttcttcgtccgcaacctcctcgaacgcgggagtggaccccaat
actaccaacctgcgccccacaacgtatgacacctggtgcggcgtggcccatggatgcacc
aggaaactggggctgaagatctgcggcttcttgcagaggaccaacagcctggaagagaag
agcaggcttgtgagcgccttcaaggagaggcagtcctccaagaacctgctttcctgtgaa
aacagtgacaaggatggccgcttccgacgcacggagacagacttctccaacctgttcgcc
cgagatctgcttccggctaagaacggggaggagcaaactgtgcagttcctgttggaggtg
gtggacatactcctcaactatgtccggaagacattcgatcgctccaccaaagtgctggac
ttccaccacccccaccagctgctggaaggcatggagggcttcaacttggaactctctgac
caccccgagtccctggagcagatcctggttgactgcagagacaccctgaaatatggggtc
cgcacaggtcatcctcgatttttcaaccagctctccacaggattggatatcattggttta
gctggcgagtggctgacatcaactgccaataccaatatgtttacatatgaaattgcacca
gtgtttgtcctcatggagcaaataacacttaagaagatgagagagatagttggatggtca
agtaaagatggtgatgggatattttctcctgggggagccatatccaacatgtacagcatc
atggctgctcgcttcaagtacttcccggaagttaagaccaagggtatggcggctgtgccc
aagcttgtcctcttcacctcagaacacagtcactattccataaagaaagctggggctgcc
cttggctttggaaccgacaatgtgattttgataaagtgcaatgaaagggggaagataatt
ccagctgatttagagacaaaaattcttgaagccaagcaaaagggttacgtccctctgtac
gtcaatgcaactgctggcaccactgtttatggcgcttttgatccaatacaggagattgca
gatatatgtgagaaatacaacctttggctgcatgtcgatgctgcctggggcggcgggctg
ctcatgtcccagaagcaccgccataaactcagtggcatcgagagggccaactctgtcacc
tggaaccctcacaagatgatgggtgtgctgctgcagtgctctgccattcttgtaaaagaa
aagggtatcctccaaggatgcaaccagatgtgtgcaggatacctcttccagccggacaag
cagtatgatgtctcctatgacactggggacaaggccattcagtgcggccgccacgtagac
atcttcaagttctggctgatgtggaaagcaaagggtacagtgggctttgaaaatcaggtc
aacaaatgcttggaactggctgaatacctctatgccaagattaaaaacagagaagaattt
gagatggtttttgatggtgagcctgagcatacgaacgtctgtttctggtatattccacaa
agcctcaggggtgttccggatagccctgaacgacgggaaaagctacacagggtggccccg
aaaatcaaagccctgatgatggaatctggcacaaccatggttggctaccagcctcagggg
gacaaggccaacttcttccggatggtcatctccaacccagccgctacccaatctgatatt
gacttcctgattgaggagatagagaggctgggccaggatctgtaa

DBGET integrated database retrieval system