KEGG   Ovis aries (sheep): 101117423Help
Entry
101117423         CDS       T03117                                 

Gene name
GANC
Definition
(RefSeq) neutral alpha-glucosidase C isoform X4
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
oas  Ovis aries (sheep)
Pathway
oas00052  Galactose metabolism
oas00500  Starch and sucrose metabolism
oas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101117423 (GANC)
   00500 Starch and sucrose metabolism
    101117423 (GANC)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101117423 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101117423
NCBI-ProteinID: XP_004011038
Ensembl: ENSOARG00000020521
LinkDB All DBs
Position
7
AA seq 1017 aa AA seqDB search
MESAEKEEISVEDEAVDKNIFKDCSKIAFYRRQKQLLSKKSTYRALLDSVTTGKDSASFQ
IINETAKVPLLAEVFGIEGNIFRLKINEEIPLKPRYEVTDVLTSKLTTVRLTSCPGDTGS
LVLASGKGDLKCHVTANPFKVDLVSEEEVVMSINSLGQLYFEQLQIPPKQRATKKNEEDA
SVDTTQENQEELGLWEEKFENFVDVKVNGPASIGLDFSLHGFEHLYGIPQHADSHQLKNT
SDGDAYRLYNLDVYGYKIHDKMGIYGSVPYLLAHKLGRTLGIFWLNASETLVEIKTEPAV
KYTLTQMGPVAAKQKVGFRTDVHWMSESGIIDVFLLTGPTPSDVFKQYSYLTGTQAMPPL
FALGYHQCRWNYEDEQDVKAVDAGFDEHNIPYDVMWLDIEHTEGKRYFTWDKKRFPNPKR
MQDLLRSKKRKLVVISDPHIKVDPNYSVYAKAKEQGFFVRNHDGGDFEGVCWPGLSSYLD
FTNPKVREWYSSLFAFSVYQGSTDILYVWNDMNEPSVFKGPEQTMQKNAIHHGNWEHREL
HNIYGFYQQMATTEGLIQRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSYLKISIP
MLLTLSVTGISFCGADVGGFIGDPEAELLVRWYQAGAYQPFFRGHATRNTKRREPWLFGE
EHTRLIREAIRERYTLLPYWYSLFYSTHVASQPVMRPLWVEFPNELETFSVEDEYMLGSA
LLVHPVTEPKASVVDVFLPGSSEIWYDSKTFAHWKGACTVKIPVTLDAIPVFQRGGSVVP
IKTTIGRSTGFMTDSPYGLRVALSTKGSAMGEFYLDDGHSFQYLHRKQFLHRKFSFSSGV
LTNSCADETSHYSSKCVVEQILVLGLKKQPSSVTAHLADGTARPVAFTYHATTSTLNLET
LSLNVGADWKARRLRHQMKGGSNLLNHGDGNDSQPQYSSLENPMDRGAWRATVHRVTESD
MTERLTHTLPLQLHRLSKGATSLDCEPRHQLQMLPPLFCSARAAVKTLGLFLGGMGE
NT seq 3054 nt NT seq  +upstreamnt  +downstreamnt
atggaatcagctgagaaagaggaaatcagtgttgaagatgaagctgtggataaaaacatt
ttcaaagactgcagcaagattgctttctacaggcgtcagaaacagctgctctccaagaag
tctacctatcgggcattattggactcagtcacaacaggcaaagacagtgccagctttcaa
atcatcaatgaaacagcaaaggttccactcctggctgaagtttttggcatagagggaaat
attttcagacttaaaatcaatgaagaaatacccttgaaacccaggtatgaagttactgat
gtcctcacaagcaagctaaccactgtaaggctgacttcttgcccaggggatacaggcagt
ctggtgctggcaagtgggaaaggagatctgaagtgtcacgtcacggcaaacccattcaag
gtcgacttggtatctgaagaagaggttgtaatgagcataaactccctgggccaattgtac
tttgagcagctgcagattcctcccaagcaaagagctaccaagaaaaatgaggaggatgca
tccgttgacaccactcaggaaaatcaagaggaactgggcctgtgggaggagaaatttgaa
aattttgtggatgtcaaagttaatggtcctgcctccattggtttggatttctctttgcat
ggttttgagcatctctacggaatcccgcaacatgctgactcacaccaacttaaaaacaca
agtgatggtgatgcttaccgtctttataacctagatgtctatggatataaaatacatgac
aaaatgggcatttatggttcagtgccttatctcctggcccacaaactgggcagaactcta
ggcattttttggctaaatgcctcagaaacactagtagagatcaaaacagaacctgctgta
aagtacacactgacccagatgggcccagttgctgctaaacaaaaggtcgggtttcgaact
gatgtgcactggatgtcagagagtggaattattgatgtttttctgttgacaggacctact
ccttctgacgtcttcaagcagtattcataccttacaggcacacaagccatgccccctctc
tttgctctggggtaccatcaatgccgctggaactatgaagatgagcaggatgtaaaggca
gtggatgcaggatttgatgaacataacattccttatgatgtcatgtggctggacatagag
cacacagagggcaagaggtacttcacctgggacaagaaaagattcccaaaccccaaaagg
atgcaagatctgctcaggagcaaaaaacgtaagcttgtggtcattagtgacccccacatc
aaggttgatcccaactactcagtgtatgctaaggccaaagaacagggcttttttgtgagg
aatcatgacggaggagactttgaaggtgtatgctggcctggtctctcctcttacctggac
ttcaccaaccccaaagtcagagagtggtattctagtctcttcgctttctctgtttatcag
ggatctactgacatcctctacgtatggaacgacatgaatgagccctctgtctttaaaggc
ccggagcaaaccatgcagaagaatgccattcatcacggcaactgggagcaccgggaactt
cacaacatctatggcttttatcagcaaatggccactacagaaggactgatccagcgatct
aaaggaaaggagagaccctttgttcttacacgttcattctttgctggatcacagaaatat
ggtgctgtgtggacaggtgataacacagcagagtggagttacctgaaaatttctatccct
atgttgcttaccctcagcgtgactgggatctctttttgtggagcggatgtaggtggcttc
atcggggatccagaggcagagctgctagtgcggtggtaccaggcaggagcctaccagccc
ttcttccgtggccatgccaccaggaacaccaagcgacgggaaccctggctctttggggag
gagcacacccggctcatccgagaagccatcagagagcgctacaccctcctgccctactgg
tattctctgttctactctacacacgtggcttctcaacctgtcatgaggcctctgtgggta
gagttccctaatgaattagagacttttagtgtggaagatgaatacatgctgggaagtgct
ttattggttcatccagtcacagaaccaaaagcttctgtggttgatgtgtttctgccaggg
tcaagtgagatttggtacgactctaagacatttgctcactggaaaggagcgtgtacagta
aaaatcccagtaaccctggatgctataccagtgtttcaacgtggtggaagtgtggtacca
ataaagaccactatagggagatccacaggcttcatgactgattccccatatggactccga
gtggctctaagcactaagggttctgccatgggtgaattctatctcgatgatgggcattct
ttccagtacctccaccggaagcaattcttgcacaggaagttttcattttcctcaggtgtt
ttgaccaacagttgtgctgacgagaccagtcattattccagcaagtgtgtggtggagcag
atcttggtcctaggcctcaagaagcagccatcttctgtgactgcccacttagctgatggc
accgctcggcctgtggcttttacataccatgccacaacatccaccctgaacctggagacg
ctctcgctgaacgttggtgctgactggaaggcaagaagactgagacatcagatgaaagga
ggaagtaacctacttaatcatggagatgggaatgacagccaaccccagtattcttccctg
gaaaatcccatggacagaggagcctggcgggctacagtccatagggtcacagagtcggac
atgactgagcgactaacacacacactccccctacagctgcacaggctcagcaagggagcc
acaagcctagactgtgaacctagacatcagcttcagatgctccctcctctgttctgctct
gcaagagcagcagtaaagacccttgggcttttccttggagggatgggagaataa

DBGET integrated database retrieval system