KEGG   Ovis aries (sheep): 101117526
Entry
101117526         CDS       T03117                                 

Gene name
E2F1
Definition
(RefSeq) transcription factor E2F1
  KO
K17454  transcription factor E2F1
Organism
oas  Ovis aries (sheep)
Pathway
oas01522  Endocrine resistance
oas04110  Cell cycle
oas04137  Mitophagy - animal
oas04218  Cellular senescence
oas04934  Cushing syndrome
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05163  Human cytomegalovirus infection
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05169  Epstein-Barr virus infection
oas05200  Pathways in cancer
oas05206  MicroRNAs in cancer
oas05212  Pancreatic cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05219  Bladder cancer
oas05220  Chronic myeloid leukemia
oas05222  Small cell lung cancer
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101117526 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    101117526 (E2F1)
   04218 Cellular senescence
    101117526 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101117526 (E2F1)
   05206 MicroRNAs in cancer
    101117526 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101117526 (E2F1)
   05225 Hepatocellular carcinoma
    101117526 (E2F1)
   05226 Gastric cancer
    101117526 (E2F1)
   05214 Glioma
    101117526 (E2F1)
   05220 Chronic myeloid leukemia
    101117526 (E2F1)
   05218 Melanoma
    101117526 (E2F1)
   05219 Bladder cancer
    101117526 (E2F1)
   05215 Prostate cancer
    101117526 (E2F1)
   05224 Breast cancer
    101117526 (E2F1)
   05222 Small cell lung cancer
    101117526 (E2F1)
   05223 Non-small cell lung cancer
    101117526 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101117526 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101117526 (E2F1)
   05161 Hepatitis B
    101117526 (E2F1)
   05160 Hepatitis C
    101117526 (E2F1)
   05163 Human cytomegalovirus infection
    101117526 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101117526 (E2F1)
   05169 Epstein-Barr virus infection
    101117526 (E2F1)
   05165 Human papillomavirus infection
    101117526 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101117526 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    101117526 (E2F1)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    101117526 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 101117526
NCBI-ProteinID: XP_027832892
UniProt: A0A6P7ENG1
LinkDB
Position
13
AA seq 437 aa
MAVAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISTAQDASAPPAPAGPAAPAAGPRD
PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLNLETDHQYLAESSGPARGRGRHPGKGVK
SPGEKSRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLI
AKKSKNHIQWLGNHATVGIGGRLEGLTQDLQQLQESEQQLDHLLHICSTQLRLLSEDADS
QRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPE
ESVGGTSPGKTPSQGAASGEEERAADLATAVPPPPSSPPSSPATDPSQSLLSLEQEPLLS
RMGGLRAPVDEDRLSPLVAADSLLEHVKEDFSGLLPEEFISLSPPHEALDYHFGLEEGEG
IRDLFDCDFGDLTPLDF
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggccgtggccggggcccccgcgggcggcccttgcgcgccggcgctggaggccttgctc
ggggccggcgcgctgcggctgctcgactcctcgcagatcgtcatcatctccaccgcgcag
gacgccagcgccccgccggcccccgccggccccgccgcaccggccgccggcccccgggac
cctgacctgctgctcttcgccacgccgcaggcgccccggcccacacccagcgcgccgcgc
cccgcgctcggccgcccgccggtgaagcggaggctgaacctggaaactgaccatcaatac
ctggccgagagcagcgggccagctcggggcagaggccgccacccaggaaaaggtgtgaag
tccccaggggagaagtcacgctatgaaacatcgttgaacctgaccaccaaacgcttcttg
gagttactgagccgctcggccgatggggtggtcgacctgaactgggcggctgaggtgctg
aaggtgcagaaacggcgcatctacgacatcaccaacgtcctggagggcatccagctcatc
gccaagaagtccaagaaccacatccagtggctaggcaaccatgcaacggtggggatcggt
gggcggcttgaaggattgacccaggacctccagcaactgcaggagagcgagcagcagctg
gatcacctgctccacatctgcagcacccagctgcgtctgctctccgaggatgcggacagc
cagcgcctggcctatgtgacctgccaggaccttcgtagcattgcagaccctgcagagcag
atggtcatggtgatcaaggccccccctgagacccagctccaagccgtggactcctcggag
aactttcagatctcccttaagagcaaacaaggccccatcgacgttttcctgtgccctgag
gagagcgtgggcggaaccagccctggaaagaccccgtcccagggggcagcttcgggggag
gaggagagggcagctgaccttgccaccgcggtgccaccaccaccgtcgtcacctccctca
tcccctgccacggatcccagtcagtccctgctcagcctggagcaagagcctctgctttcc
cggatgggtggcctgcgggcccccgtggacgaggaccgcctgtccccactcgtggcggcc
gactcactcctggagcacgtgaaggaggacttctccggcctcctccccgaggagttcatc
agcctgtcgcccccgcatgaggccctcgactaccactttggcctcgaggagggtgagggc
atcagagacctcttcgactgtgactttggggacctcactcccctggatttctga

KEGG   Ovis aries (sheep): 101121809
Entry
101121809         CDS       T03117                                 

Gene name
E2F3
Definition
(RefSeq) transcription factor E2F3
  KO
K06620  transcription factor E2F3
Organism
oas  Ovis aries (sheep)
Pathway
oas01522  Endocrine resistance
oas04110  Cell cycle
oas04218  Cellular senescence
oas04934  Cushing syndrome
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05163  Human cytomegalovirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05169  Epstein-Barr virus infection
oas05200  Pathways in cancer
oas05206  MicroRNAs in cancer
oas05212  Pancreatic cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05219  Bladder cancer
oas05220  Chronic myeloid leukemia
oas05222  Small cell lung cancer
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101121809 (E2F3)
   04218 Cellular senescence
    101121809 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101121809 (E2F3)
   05206 MicroRNAs in cancer
    101121809 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101121809 (E2F3)
   05225 Hepatocellular carcinoma
    101121809 (E2F3)
   05226 Gastric cancer
    101121809 (E2F3)
   05214 Glioma
    101121809 (E2F3)
   05220 Chronic myeloid leukemia
    101121809 (E2F3)
   05218 Melanoma
    101121809 (E2F3)
   05219 Bladder cancer
    101121809 (E2F3)
   05215 Prostate cancer
    101121809 (E2F3)
   05224 Breast cancer
    101121809 (E2F3)
   05222 Small cell lung cancer
    101121809 (E2F3)
   05223 Non-small cell lung cancer
    101121809 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101121809 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101121809 (E2F3)
   05161 Hepatitis B
    101121809 (E2F3)
   05160 Hepatitis C
    101121809 (E2F3)
   05163 Human cytomegalovirus infection
    101121809 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101121809 (E2F3)
   05169 Epstein-Barr virus infection
    101121809 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101121809 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    101121809 (E2F3)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    101121809 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 101121809
NCBI-ProteinID: XP_027815007
Ensembl: ENSOARG00000009655
UniProt: A0A6P7D8I1
LinkDB
Position
20
AA seq 334 aa
MPLQQQAKRRLELGESGQQYLSDGLKTPKGKGRAALRSPDSPKKKTRYDTSLGLLTKKFI
QLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCSLSEDGG
MLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTYQDIRKISGLK
DQTVIVVKAPPETRLEVPDPIESLQIHLASTQGPIEVYLCPEETETHSPMKTNNQDHNGN
IPKPTSKDLASTNSGHSDCSISMANLSPLASPANLLQQTEDQIPSNLEGPFVNLLPPLLQ
EDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgcccttacagcagcaggcaaagcgcaggctggagctaggagaaagcggccagcagtac
ctctcagatggtttaaaaacccccaagggcaaaggaagagcggcactccggagtccagac
agcccaaaaaaaaaaacacggtatgatacatcccttggtctgctcaccaagaagttcatt
cagctactgagccaatcacctgatggggtcttggatttgaacaaggcagcagaggtgctg
aaggtgcaaaagagaaggatttacgacatcaccaatgtcctggaaggcatccacctcatt
aagaagaagtctaaaaataacgtgcagtggatgggctgcagtctatctgaggacgggggc
atgctggcccagtgtcaaggcctgtcaaaagaagtgaccgagctcagtcaggaagagaag
aaattagatgaactgatccaaagctgcaccctggacctcaaactgttaaccgaggattca
gagaatcaaaggttagcttatgttacatatcaagatattcgaaaaattagtggccttaaa
gaccaaactgttatagttgtgaaagcccctccagaaacaagacttgaagtgcctgaccca
atagagagcctacagatacatttggcaagtacccaaggacccattgaggtttatttgtgt
ccagaagagactgaaacacacagtccaatgaaaacaaacaaccaagaccacaatgggaat
atccctaaacccacttccaaagacttggcttcaaccaactcaggacatagtgattgctcg
atttctatggcaaacctttctcctctggcctccccggccaaccttttacagcagactgag
gaccaaattccttccaacctagaaggaccatttgtgaacttactgcctcccctgctccaa
gaagactatctcctaagcctcggggaggaagaaggcatcagcgatctctttgatgcttat
gatttggaaaagctcccgctggtggaagactttatgtgtagttga

KEGG   Ovis aries (sheep): 105606975
Entry
105606975         CDS       T03117                                 

Gene name
E2F2
Definition
(RefSeq) transcription factor E2F2
  KO
K09389  transcription factor E2F2
Organism
oas  Ovis aries (sheep)
Pathway
oas01522  Endocrine resistance
oas04110  Cell cycle
oas04218  Cellular senescence
oas04934  Cushing syndrome
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05163  Human cytomegalovirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05169  Epstein-Barr virus infection
oas05200  Pathways in cancer
oas05206  MicroRNAs in cancer
oas05212  Pancreatic cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05219  Bladder cancer
oas05220  Chronic myeloid leukemia
oas05222  Small cell lung cancer
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105606975 (E2F2)
   04218 Cellular senescence
    105606975 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105606975 (E2F2)
   05206 MicroRNAs in cancer
    105606975 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    105606975 (E2F2)
   05225 Hepatocellular carcinoma
    105606975 (E2F2)
   05226 Gastric cancer
    105606975 (E2F2)
   05214 Glioma
    105606975 (E2F2)
   05220 Chronic myeloid leukemia
    105606975 (E2F2)
   05218 Melanoma
    105606975 (E2F2)
   05219 Bladder cancer
    105606975 (E2F2)
   05215 Prostate cancer
    105606975 (E2F2)
   05224 Breast cancer
    105606975 (E2F2)
   05222 Small cell lung cancer
    105606975 (E2F2)
   05223 Non-small cell lung cancer
    105606975 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105606975 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105606975 (E2F2)
   05161 Hepatitis B
    105606975 (E2F2)
   05160 Hepatitis C
    105606975 (E2F2)
   05163 Human cytomegalovirus infection
    105606975 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105606975 (E2F2)
   05169 Epstein-Barr virus infection
    105606975 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    105606975 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    105606975 (E2F2)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    105606975 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 105606975
NCBI-ProteinID: XP_027821338
UniProt: A0A6P7DRE7
LinkDB
Position
2
AA seq 436 aa
MLRGPRALAPAAGPPPKGLPAMSPTELWSPGLSSPQLCPTTTYYTQMYPQTVPPAAAPGT
CLDATPHGPEGQAVRCVPAGRLPAKRKLDLEGIGRPTVPEFRTPKGKCIRVDGLPSPKTP
KSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQL
IRKKAKNNIQWVGRGLFEDPTRPGKQQQLGQELKELMSMEQALDQLIHSCSLNFKHLTED
KANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRSEENLQIHLKSTQGPIEVY
LCPEEVQEPHSPAREPLPSTSALSPSPDSTQPSSNSDPGITEPMASSEPALTSPQVLPPP
PPPLVPLEATENMLELPHPLLQQTEDQFLSPTLPGSSPLISFSPPLDQDDYLWGLDGGEG
ISDLFDTYDLGDLLIN
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgctgcgggggcctcgggccctggctcctgcagccgggccacccccaaaggggctgccc
gcgatgagccccacggagctgtggtcgccgggcctcagcagcccccagctctgcccgacc
accacctactacacccagatgtacccgcagactgtgcctcccgctgcggcgcccggcacc
tgcctcgacgccaccccccacggaccggagggtcaagctgtgcgatgcgtgccggctggc
cggctgccggccaaaaggaagctggacctggaggggatcgggaggcccacggtccctgaa
ttccggactcccaaggggaagtgcattagagtggatggcctccccagccccaaaaccccc
aagtcccctggggaaaagactcgctatgacacatcgctggggctgctcaccaagaaattc
atttacctcctgagtgagtctgaggatggggttctggacctgaactgggctgctgaggtg
ctggacgtgcagaagcgacgcatctacgacatcaccaacgtgctggagggcatccagctc
atccgcaagaaggccaagaacaacatccagtgggtaggcaggggactgtttgaagacccc
acgcggcctgggaagcagcagcagttggggcaggagctgaaggagctgatgagcatggag
caggccctggaccagctcatccacagctgctctctgaacttcaagcacctgacagaggac
aaggccaacaagagactggcctatgtgacgtaccaggacatccgtgctgtgggcaacttt
aaggagcagacggtgattgcggtcaaggcccctccgcagacgagactggaggtgcctgac
aggagtgaggaaaacctgcagatacatctgaagagcacccaggggcccatcgaggtttac
ctgtgcccagaagaggtgcaggagccccacagtcctgccagggagccccttccctccact
tccgccctcagccccagccctgactccacccagcccagcagcaacagcgaccctgggatc
acggaacccatggcatcctcagagccagcactgacgtccccgcaggtcctgccaccaccc
ccgcctccccttgtccccctggaggccacggagaacatgctggagctgccgcacccactg
ctgcagcagactgaggaccagttcctgtccccgacgctgcccggcagctcccctctgatc
agcttctccccgcccttagaccaggatgactacctgtggggcctggacggcggggagggc
atcagcgacctcttcgacacctatgatctcggggacctgctgattaactga

DBGET integrated database retrieval system