KEGG   Ovis aries (sheep): 101117666
Entry
101117666         CDS       T03117                                 

Gene name
SHH
Definition
(RefSeq) sonic hedgehog protein isoform X1
  KO
K11988  sonic hedgehog
Organism
oas  Ovis aries (sheep)
Pathway
oas04340  Hedgehog signaling pathway
oas04360  Axon guidance
oas05200  Pathways in cancer
oas05205  Proteoglycans in cancer
oas05217  Basal cell carcinoma
oas05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101117666 (SHH)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    101117666 (SHH)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101117666 (SHH)
   05205 Proteoglycans in cancer
    101117666 (SHH)
  09162 Cancer: specific types
   05226 Gastric cancer
    101117666 (SHH)
   05217 Basal cell carcinoma
    101117666 (SHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:oas01002]
    101117666 (SHH)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:oas00536]
    101117666 (SHH)
Peptidases and inhibitors [BR:oas01002]
 Cysteine peptidases
  Family C46: hedgehog family
   101117666 (SHH)
Glycosaminoglycan binding proteins [BR:oas00536]
 Heparan sulfate / Heparin
  Morphogens
   101117666 (SHH)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 101117666
NCBI-ProteinID: XP_027824863
Ensembl: ENSOARG00000006942
UniProt: A0A6P7E1A0
LinkDB
Position
4
AA seq 464 aa
MGEMLLLARCLLVLLVSSLLMCSGLACGPGRGFGKRRNPKKLTPLAYKQFIPNVAEKTLG
ASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQW
PGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYES
KAHIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDEGRLLYSD
FLTFLDRDRGAKKVFYAIETREPRERLLLTAAHLLFVAPHNGSAAGAPEGAAAAAAAAAA
GGGAPGRRALFASRVRPGQHVYVVAERGGARRLLPAAVHSVTLREETAGAYAPLTAHGTI
LINRVLASCYAVIEEHSWAHGAFAPYRLAHALLAALAPGRTDRGGAGDSGGGGRVPAPAP
GAPGAADAPGAAGIHWYSELLYQIGTWLLDSEALHPLGMAVKSS
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgggcgagatgctgctgctggcgagatgtctgctggtgctgctggtctcctcgctgttg
atgtgctcggggctggcgtgcggacccggcaggggatttggcaagaggcggaaccccaaa
aagctgacccctttagcctacaagcagtttatccccaacgtggcggagaagacgctaggg
gccagtggaagatacgaggggaagatcaccagaaactcagagcgatttaaggaactcacc
cccaattacaaccccgacatcatatttaaggatgaagaaaacactggagcggaccggctg
atgactcagaggtgcaaggacaagctgaacgccttagccatctccgtgatgaaccagtgg
ccgggcgtgaagctgcgggtgaccgagggctgggacgaggacggccaccactcggaggag
tcgctgcactacgagggccgcgctgtggacatcaccacctcggaccgcgaccgcagcaag
tacggcatgctggcacgcctggccgtggaggccggcttcgactgggtctactacgagtcc
aaggcacacatccactgctcagtgaaagcagagaactcggtggcggccaagtcgggcggc
tgcttcccgggctcggccacggtgcacctggagcagggcggaaccaagctggtgaaggac
ctgcggcccggggaccgcgtgctggcggccgacgacgagggccggctgctctacagcgac
ttcctcaccttcctggaccgcgaccgcggcgccaagaaggtcttctacgccatcgagacg
cgggagcctcgcgagcgcctgctgctcaccgccgcgcacctgctcttcgtggcgccgcac
aacggctcggccgcgggggcgcccgagggggcggcggcggccgcggcggcggccgcggcg
ggcgggggcgcgccggggcgccgggcgctcttcgccagccgcgtgcggccgggccagcac
gtgtacgtggtggccgagcgcggcggggcccggcggctgctgcccgccgcggtgcacagc
gtgacgctgcgcgaggagacggcgggcgcctacgcgccgctcacggcgcacgggaccatc
ctcatcaaccgggtgctggcctcgtgctacgcggtcatcgaggagcacagctgggcgcac
ggggccttcgcgccctaccgcctcgcgcacgcgctcctggccgcgctggcgcccgggcgc
acggaccgcggtggagccggcgacagcgggggcggcggccgcgtccccgcgcccgcgccg
ggggcgccgggggcggcggacgcgccgggcgccgcgggcatccactggtactcggagctg
ctctaccaaataggcacctggctgttggacagcgaggccttgcacccgctgggcatggcg
gtcaagtccagctga

DBGET integrated database retrieval system