KEGG   Ovis aries (sheep): 101117810Help
Entry
101117810         CDS       T03117                                 

Definition
(RefSeq) glutamate decarboxylase 1-like isoform X1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
oas  Ovis aries (sheep)
Pathway
oas00250  Alanine, aspartate and glutamate metabolism
oas00410  beta-Alanine metabolism
oas00430  Taurine and hypotaurine metabolism
oas00650  Butanoate metabolism
oas01100  Metabolic pathways
oas04727  GABAergic synapse
oas04940  Type I diabetes mellitus
Module
oas_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    101117810
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101117810
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101117810
   00430 Taurine and hypotaurine metabolism
    101117810
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    101117810
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    101117810
Enzymes [BR:oas01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     101117810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS
Motif
Other DBs
NCBI-GeneID: 101117810
NCBI-ProteinID: XP_014959048
Ensembl: ENSOARG00000005851
LinkDB All DBs
Position
23
AA seq 528 aa AA seqDB search
MRKKSIHACQSTDKDVIKEAHAENLMTNLSNAYASDLLPSKEGEDLTKCFLLRVVNILLH
YIEKTFDVKSKILDFHHPHQLLEGLDGFDLELSDHPESLEQLLVDCTDTLKYGVKTGHPR
YFNQLSSGLDVIGLAGEWLTATANTNMFTYEIAPVFTVMETVLLKKMCEIIGWRETEADG
IFSPGGSISNLYGILVARYKQYPEIKARGMAVLPCIVLFVSEQGHYSIRKAAATLGIGTD
NVIEVKCDERGKMIPAELEKNILQAKRKGQTPFCVVATAGSTVFGAFDPLHDIADICEIH
RLWMHVDAAWGGGLLLSRTHSYKLSGIERADSVTWNPHKLMGVPLQCSALLTREKGLLGA
CNQMQAEYLFQPDKVYNINFDTGDKTIQCGRHVDVFKLWLMWKAKGTYGFEVQIDRYMEL
AKYFYKVLKKKDNFKLVFDAEPEFTNVCFWYFPPRLKHIPESFERDQELQKIAPKIKAQM
IVEGTVMLSYQPCGDKVNFFRMVFSNPATRQTDVDYLIDEIQRLGKDL
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaatccattcatgcttgtcaatcaactgacaaagacgtgataaaagaagct
catgctgagaatctaatgactaatttatcaaatgcttatgcttcagatttgttgccatcc
aaggagggcgaagatttaacaaagtgttttctgctgcgagtggtaaatattcttctgcac
tacattgagaaaacttttgatgttaagagtaaaatattggactttcatcatcctcatcag
cttcttgaaggtttggatgggtttgacttagaactgtctgaccatcctgaatctctggag
cagttgcttgttgattgcacagacaccttaaaatatggtgtaaaaacaggacatcctcgc
tattttaaccagctctccagtgggctagatgtgattggacttgcaggggaatggttgaca
gctactgcaaataccaacatgtttacctatgaaatagctccagtatttactgtcatggaa
acagttcttcttaagaaaatgtgtgaaattattggctggagagaaacagaagcagatgga
atattttcacctggtgggagtatatcaaacctctatggtatattagtagctcgttataag
caatacccagagataaaagcaagaggcatggcagtccttccatgcattgtattgtttgtt
tctgaacaaggtcattattccataagaaaagctgcagcaactcttggtattggaacagat
aatgtaattgaagtaaaatgtgatgaaaggggaaagatgattccagctgagttagagaaa
aatatattacaagctaaaagaaagggccagactcctttctgtgtggtggccacagctggc
agcaccgtgttcggggccttcgacccgctccatgacatcgcagatatttgtgagatacac
agactctggatgcacgtggatgcagcttggggaggtggattgctgttgtccagaacgcat
tcctataaactcagtggcatcgaaagggccgactccgtgacctggaacccccacaaactc
atgggtgtgccccttcagtgctctgctctcctgacccgggaaaaaggtcttctgggagca
tgcaaccagatgcaggctgaataccttttccagccagataaagtctacaatattaacttt
gacaccggggataaaactattcaatgcggccgacatgttgatgtctttaagctctggtta
atgtggaaggcaaagggaacctatggctttgaggtacagattgacagatatatggaactg
gcaaaatacttctataaagttttaaagaaaaaagataactttaagcttgtatttgatgca
gagcctgagttcaccaatgtctgcttctggtatttcccaccaagacttaaacacatccca
gaaagttttgaaagagatcaagaactgcaaaagattgctccaaagattaaagcccagatg
atagtggaaggtacagtcatgctcagctaccagccctgtggggacaaagtaaattttttc
cgaatggtcttttctaatcctgccacaagacaaacagatgttgactatcttattgatgaa
attcaaagacttgggaaagatttatga

DBGET integrated database retrieval system