KEGG   Ovis aries (sheep): 101118185
Entry
101118185         CDS       T03117                                 

Gene name
HBEGF
Definition
(RefSeq) proheparin-binding EGF-like growth factor
  KO
K08523  heparin-binding EGF-like growth factor
Organism
oas  Ovis aries (sheep)
Pathway
oas01522  Endocrine resistance
oas04012  ErbB signaling pathway
oas04912  GnRH signaling pathway
oas04915  Estrogen signaling pathway
oas04928  Parathyroid hormone synthesis, secretion and action
oas05171  Coronavirus disease - COVID-19
oas05205  Proteoglycans in cancer
oas05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101118185 (HBEGF)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101118185 (HBEGF)
   04915 Estrogen signaling pathway
    101118185 (HBEGF)
   04928 Parathyroid hormone synthesis, secretion and action
    101118185 (HBEGF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101118185 (HBEGF)
  09162 Cancer: specific types
   05219 Bladder cancer
    101118185 (HBEGF)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101118185 (HBEGF)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101118185 (HBEGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:oas00536]
    101118185 (HBEGF)
Glycosaminoglycan binding proteins [BR:oas00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101118185 (HBEGF)
SSDB
Motif
Pfam: EGF
Other DBs
NCBI-GeneID: 101118185
NCBI-ProteinID: XP_004008912
Ensembl: ENSOARG00000017521
UniProt: W5Q7W2 A0A6P3E9M8
LinkDB
Position
5
AA seq 208 aa
MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNLDSPTQSTDQLLPAGGAQGRE
VLDLEEANLDLFRAAFSSKPQALATPSKEERGKRKKKGKGLGKKRNPCLRRYKDFCIHGE
CKYVKELRVPTCICHPGYHGERCHGLSLPVKNRLYTYDHTTILVVVAVVLSSVCLLVIMG
LLMFWYHRRGGYDVENEEKVKLGMTTSH
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaagctgctgccgtcggtggtgctgaagctctttcttgctgcagtgctttcggcgttg
gtgactggcgagagcctggagcggcttcggagaggcctggctgctggaaccagcaatctg
gactcccctactcaatctacggaccagctgctgcccgcgggaggtgcccaaggccgggaa
gtcctggacttggaagaggcaaacctggaccttttcagagctgctttttcctccaagcca
caagctctggccacaccaagcaaggaggagcgtgggaaaagaaagaagaaaggcaagggg
ttagggaagaagagaaacccatgtcttcggcgatacaaggacttctgcatccacggagaa
tgcaaatacgtgaaggagctccgggttccaacctgcatctgccacccaggttatcacgga
gagaggtgccatgggctgagcctcccggtgaaaaatcgcttatatacgtacgatcacaca
accatcctggttgtggtggctgtggtgctgtcatccgtctgtctgctggtcatcatgggg
cttctcatgttttggtaccacaggagaggaggttatgacgtggaaaatgaagagaaagtg
aagttgggcatgactacgtcccactga

DBGET integrated database retrieval system