KEGG   Ovis aries (sheep): 101118332
Entry
101118332         CDS       T03117                                 

Gene name
PLAT
Definition
(RefSeq) tissue-type plasminogen activator
  KO
K01343  tissue plasminogen activator [EC:3.4.21.68]
Organism
oas  Ovis aries (sheep)
Pathway
oas04371  Apelin signaling pathway
oas04610  Complement and coagulation cascades
oas05202  Transcriptional misregulation in cancer
oas05215  Prostate cancer
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101118332 (PLAT)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101118332 (PLAT)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101118332 (PLAT)
  09162 Cancer: specific types
   05215 Prostate cancer
    101118332 (PLAT)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101118332 (PLAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:oas01002]
    101118332 (PLAT)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:oas00536]
    101118332 (PLAT)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.68  t-plasminogen activator
     101118332 (PLAT)
Peptidases and inhibitors [BR:oas01002]
 Serine peptidases
  Family S1: chymotrypsin family
   101118332 (PLAT)
Glycosaminoglycan binding proteins [BR:oas00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   101118332 (PLAT)
SSDB
Motif
Pfam: Trypsin Kringle fn1 DUF1986 EGF hEGF Trypsin_2
Other DBs
NCBI-GeneID: 101118332
NCBI-ProteinID: XP_011961401
Ensembl: ENSOARG00000003130
UniProt: W5NYU0 A0A6P3TAJ4
LinkDB
Position
26
AA seq 565 aa
MTNAMKTQFLCLLLCGAVFTWPSQETYRRLRRGARSYRVTCRDEKTQMTYLQHESWLRPL
LRGNQVEHCRCNGGRAQCHSVPVRSCSEPWCFNGGTCQQALYSSDFVCQCPEGFMGKLCE
IDTTATCYKDQGVAYRGTWSTAESGAECASWNSSGLAMKPYSGRRPDAVRLGLGNHNYCR
NPDQDSKPWCYVFKAGKYVSEFCSTPACTKVAEEDGDCYTGNGLAYRGTRSRTKSGFSCL
PWNSVFLTSKIYTAWKSNARALGLGKHNHCRNPDGDAQPWCHVWKDRQLTWEYCDVPQCV
TCGLRQYKRPQFRIKGGLFADITSHPWQAAIFVKNRRSPGQRFLCGGILISSCWVLSAAH
CFQERYPPHHLKVVLGRTYRLVPGEEEQMFEVEKYIVHKEFDDDTYDNDIALLHLKSNSL
TCAQESGSVRTICLPDASLQLPDWTECELSGYGKHEASSPFFSERLKEAHVRLYPSSRCT
SRHLFNRTVTNNMLCAGDTRSGGDHTNLHDACQGDSGGPLVCMKDNHMTLVGIISWGLGC
GQKDIPGVYTKVTNYLDWIRDNMRL
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgacaaacgcaatgaagacacagttcctgtgcctgctgctctgtggagccgtcttcacg
tggcccagccaggaaacctacagacgactcaggagaggcgccagatcgtacagagtgacc
tgcagagatgaaaaaacgcagatgacgtacctccaacacgagtcctggctgcgacccctg
cttaggggcaaccaagtggagcactgtaggtgcaacggtggccgggcccagtgccattcg
gtgcccgtcagaagttgcagtgaaccttggtgttttaatggggggacgtgtcagcaggcc
ctctattcttcagacttcgtctgccagtgcccggaagggttcatggggaagctctgtgaa
atagatactactgccacgtgctataaggaccagggtgtcgcctacagaggcacgtggagc
acggcagagagcggggctgagtgcgccagctggaacagcagcggcctggccatgaagccg
tacagcgggcgcaggcccgacgccgtcaggctcggccttgggaaccacaactactgcaga
aacccggaccaagactcaaagccctggtgctacgtcttcaaggcagggaaatacgtctct
gagttctgcagcactccagcctgcactaaggttgcagaagaagatggggactgctacact
ggaaacgggctggcataccgcggcacccgcagccgcaccaagtctgggttctcctgcctc
ccgtggaattccgtgttcctaacgagcaagatttacaccgcctggaagagcaacgcgcgg
gccctgggcctggggaagcacaatcactgcaggaatcccgatggggatgcccagccttgg
tgccacgtgtggaaggaccgtcagcttacctgggagtactgtgatgtgccccagtgcgtc
acctgtggcctgagacagtacaagcggccccagttccgcatcaaaggaggcctcttcgcc
gacatcacctcccacccctggcaggccgccatcttcgtcaagaacagacggtccccggga
cagcggtttctgtgtggggggatcctgatcagctcctgctgggtgctgtcagccgcccac
tgcttccaggagaggtacccgcctcaccatctcaaggtggtcctgggcaggacgtaccgg
ctggtccctggagaggaggagcagatgtttgaagtagaaaaatacatcgtccacaaggaa
tttgatgatgacacttacgacaatgatattgcgctgctgcacctgaaatcgaactcgctg
acctgcgcccaggagagcgggtcggtccgcaccatctgcctcccagatgccagcctgcag
ctgcccgactggacggagtgcgagctgtccggctatgggaaacacgaggcctcttctcct
ttcttttccgagcggctgaaggaggctcacgtcaggttgtacccatctagccgctgcact
tcccggcacttgtttaacaggaccgtcaccaacaacatgctgtgtgccggagacacacgg
agcggcggggaccacacaaacctgcacgatgcctgccagggtgactcgggtggccccttg
gtgtgtatgaaggacaaccacatgaccttggtcggcatcatcagctggggcctgggctgc
gggcagaaggacatcccgggcgtgtacaccaaggtgactaactacctggactggattcga
gacaacatgcgactgtga

DBGET integrated database retrieval system