KEGG   Ovis aries (sheep): 101118496
Entry
101118496         CDS       T03117                                 

Gene name
ELOB
Definition
(RefSeq) elongin-B
  KO
K03873  elongin-B
Organism
oas  Ovis aries (sheep)
Pathway
oas04066  HIF-1 signaling pathway
oas04120  Ubiquitin mediated proteolysis
oas05170  Human immunodeficiency virus 1 infection
oas05200  Pathways in cancer
oas05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101118496 (ELOB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101118496 (ELOB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101118496 (ELOB)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101118496 (ELOB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101118496 (ELOB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:oas04121]
    101118496 (ELOB)
   03400 DNA repair and recombination proteins [BR:oas03400]
    101118496 (ELOB)
Ubiquitin system [BR:oas04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Adoptor protein
     101118496 (ELOB)
   ECS complex
     101118496 (ELOB)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     101118496 (ELOB)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD
Other DBs
NCBI-GeneID: 101118496
NCBI-ProteinID: XP_027816945
Ensembl: ENSOARG00000000340
LinkDB
Position
24
AA seq 118 aa
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLAFRADEAFEALRIEPFSSPPELPDVMKPQDSGSSANEQAVQ
NT seq 357 nt   +upstreamnt  +downstreamnt
atggacgtgttcctcatgatccggcgccacaagaccaccatcttcacggacgccaaggag
tcgagcaccgtgttcgagctgaagcgcatcgtcgagggtatcctcaagcggccgccggat
gagcagcggctgtacaaggacgaccagcttctggacgacggcaagacattgggcgagtgt
ggcttcaccagccagacagcacggcctcaggcccccgccactgtggggctagccttcagg
gcagatgaggcattcgaggccctgcgcatcgagcccttctccagcccacctgagctgccg
gacgtgatgaagccacaggactcaggaagcagcgccaacgaacaggctgtgcagtga

DBGET integrated database retrieval system