KEGG   Ovis aries (sheep): 101118831Help
Entry
101118831         CDS       T03117                                 

Definition
(RefSeq) alpha-amylase 2B
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas00500  Starch and sucrose metabolism
oas01100  Metabolic pathways
oas04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101118831
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101118831
Enzymes [BR:oas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     101118831
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 101118831
NCBI-ProteinID: XP_014947635
Ensembl: ENSOARG00000018733
UniProt: W5QBM0
LinkDB All DBs
Position
1
AA seq 511 aa AA seqDB search
MRFFLLLSAIGFCWAQYDPHTKSGRTSIVHLFEWRWVDVALECERYLAPKGFGGVQVSPP
NENAVITDPSRPWWERYQPVSYKLCTRSGNENEFKDMVTRCNNVGVRIYVDAVINHMTGS
GVSAGTRSTCGSYFNPGSEDFPAVPYSGWDFNDGKCKTGSGDIESYNDAYQVRDCRLVSL
LDLALEKDYVRSTIANYLNHLIDIGVAGFRIDASKHMWPGDIKAVLDKLNNLNTKWFPSG
SKPFIYQEVIDLGGEAITSSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMAYLKNWGEGWG
FMPSNRALVFVDNHDNQRGHGAGGASILTFWDPRMYKMAVGFMLAHPYGFTRVMSSYRWT
RHFVDGTDVNDWMGPPNNNGVIKEVTINADTTCGNDWVCEHRWRQIRNMVMFRNVVDGQS
FTNWWDNGSNQVAFGRGNKGFIVFNNDDSTLSATLQTGLPAGTYCDVISGDKSGNRCTGI
QISVSSDGKAHFSISNSAEDPFIAIHADSKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaggttttttctgttgctttcagcgattgggttctgctgggctcagtatgacccacac
accaaatctggacggacatccattgttcatctgtttgaatggcgttgggttgatgttgct
cttgaatgtgagcgatacttagcccccaaaggatttggaggggttcaggtctccccaccc
aatgaaaatgctgtgattactgacccttcaagaccttggtgggaaagataccaaccagtt
agctacaagttatgtacaagatcaggaaatgaaaatgaattcaaagacatggtgactaga
tgtaacaacgttggtgtccgcatttatgtggatgctgtaattaatcatatgactggaagt
ggtgtgagtgcaggaacaagaagtacttgtggaagttacttcaaccctggaagtgaggat
tttccagcagtcccatactctggttgggattttaatgatggaaaatgtaaaactggaagt
ggagatattgagagctataatgatgcttatcaggtcagggattgtcgtctcgttagtctt
cttgatcttgcgctggagaaagattatgtgcgttccacgattgctaactacctaaatcat
ctcattgacattggtgtagcagggtttcgaattgatgcttctaagcacatgtggcctgga
gacataaaggcagttttggataaactgaataatctaaacacaaagtggtttccttcagga
agtaaacctttcatttaccaggaggtcattgatctgggtggtgaggcaattacaagcagt
gagtactttggtaatggccgtgtgacagaatttaaatatggtgcaaaactaggaacagtt
attcgcaagtggaatggagagaagatggcttacttaaagaactggggagaaggctggggt
ttcatgccttctaacagggcacttgtctttgttgataaccatgacaatcagcgagggcat
ggagctgggggagcatctattcttacattctgggatcctagaatgtacaaaatggcagtt
ggatttatgcttgctcatccctatggatttacacgagtaatgtcaagctaccgttggaca
agacattttgtggatggaacagatgttaatgattggatgggaccaccaaataataatgga
gtaattaaagaagttactattaatgcagatactacttgtggcaatgactgggtctgtgaa
catcgatggcgtcagataaggaacatggttatgttccgtaatgtagttgatggtcaatct
tttacaaactggtgggataatggcagcaaccaagtagcttttggaagaggaaacaaagga
ttcattgtctttaacaatgatgacagtacactatctgcaactttgcaaactggtcttcct
gctggtacatattgtgatgttatttctggagataaaagtggcaaccgttgtacaggaatt
caaatcagtgtttccagtgatggcaaagctcatttttctattagtaactctgctgaagat
ccatttattgcaattcatgctgattctaaattataa

DBGET integrated database retrieval system