KEGG   Ovis aries (sheep): 101119209Help
Entry
101119209         CDS       T03117                                 

Gene name
HK3
Definition
(RefSeq) hexokinase-3 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas00010  Glycolysis / Gluconeogenesis
oas00051  Fructose and mannose metabolism
oas00052  Galactose metabolism
oas00500  Starch and sucrose metabolism
oas00520  Amino sugar and nucleotide sugar metabolism
oas00524  Neomycin, kanamycin and gentamicin biosynthesis
oas01100  Metabolic pathways
oas01200  Carbon metabolism
oas04066  HIF-1 signaling pathway
oas04910  Insulin signaling pathway
oas04930  Type II diabetes mellitus
oas04973  Carbohydrate digestion and absorption
oas05230  Central carbon metabolism in cancer
Module
oas_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
oas_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:oas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101119209 (HK3)
   00051 Fructose and mannose metabolism
    101119209 (HK3)
   00052 Galactose metabolism
    101119209 (HK3)
   00500 Starch and sucrose metabolism
    101119209 (HK3)
   00520 Amino sugar and nucleotide sugar metabolism
    101119209 (HK3)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101119209 (HK3)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    101119209 (HK3)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101119209 (HK3)
  Digestive system
   04973 Carbohydrate digestion and absorption
    101119209 (HK3)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    101119209 (HK3)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    101119209 (HK3)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101119209 (HK3)
Membrane trafficking [BR:oas04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101119209 (HK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 101119209
NCBI-ProteinID: XP_004008754
Ensembl: ENSOARG00000003252
LinkDB All DBs
Position
5
AA seq 924 aa AA seqDB search
MDSIGSLGLQQGEGAPGCPQEGLPCPSNTSEMVQECLQQFKVTGAQLRQIQTSLLGSMEQ
ALRGQAGPAPAVRMLPTYVGSIPHGTEQGDFVVLELGATGASLRVLWVTLTGIEGHKVEP
RSQEFVIPQEVMLGPGQQLFDFAARCLSEFLDVLPVGNQGLQLGFSFSFPCHQTGLDKST
LISWTKGFKCSDVEGQDVVQLLRDAIQRQGAYSIDVVAVVNDTVGTMMGCEPGVGPCEVG
LVVDTGTNACYMEEARHVAVLDEDRGRVCISIEWGSFSDEGALGPVQTIFDRTLDHESLN
PGAQRFEKMIGGLYLGELVRLVLAHLAQRGALFGGHTSPVLRSQGSILLEHVAEMEDPSA
GAARVHAVLQDLGLNPKASDAEWVQCVCVAVCTRAAQLCAAALAAVLSRLQHSREQQALQ
IAVATGGRVFERHPRFLSVLRETVMLLAPDCNVSFIPSVDGGGRGVAMVTAVAARLAAHR
RLLEETLAPFRLTREQLAEVQAQMREAMAKGLQGEASSLRMLPTYVRATPDGSERGDFLA
LDLGGTNFRVLLVRVATGGVQISSQIYSIPECVAQGSGQQLFDHIVDCIVDFQQKQGLSG
QSLPLGFTFSFPCRQMGLDQGILLNWTKGFNASDCEGQDVVCLLREAIRRRQAVELNVVA
IVNDTVGTMMSCGYEDPHCEVGLIVGTGTNACYMEELRNVASVDGDSGQMCINTEWGAFG
DDGSLSMLSTRFDACVDQASINPGKQRFEKMISGMYLGEIVRHILLHLTSLGVLFRGQQT
QRLQTRDIFKTKFLSEIESDSLALRQVRAILEDLGLPLTSDDALMVLEVCQAVSKRAAQL
CGAGVAAVVEKIRENRGLEELTISVGVDGTLYKLHPHFSSLVAATVRELAPRCVVTFLQS
EDGSGKGAALVTAVACRLAQRTRV
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atggactccattgggtctctagggttgcagcaaggggaaggagcccctggctgcccccaa
gaaggcttgccttgcccctcaaacacctctgagatggtacaggagtgcctacagcagttc
aaggtgacaggggcgcagctacggcagatccagaccagcctcctgggctccatggagcag
gcactgagggggcaagcaggccctgcccctgctgtccggatgctgcccacatatgtgggg
tctatcccacatggcactgagcaaggggacttcgtggtgctggagctgggggcgacaggg
gcctcactgcgtgttctatgggtgaccctaacgggcattgaggggcacaaggtggagccc
cggagccaggagtttgtgatcccccaggaagtgatgctgggtcctggtcagcagctcttt
gactttgccgcccgctgcctgtctgagttcctggatgtgctgcccgtgggcaatcagggt
ctgcagcttgggttcagcttctccttcccttgtcaccagacaggcctggacaagagcacc
ctcatttcctggaccaaaggttttaagtgcagtgatgtggaaggccaggatgtggtccaa
ttgctacgagacgccatccagaggcagggagcctacagcattgatgttgttgctgtggtg
aatgacaccgtgggcaccatgatgggctgtgagccaggggtcgggccatgtgaagttggg
ctggtcgtagacaccggcaccaacgcatgttacatggaggaggcaaggcacgtggcagtg
ctggatgaagaccggggccgcgtctgcatcagcatcgagtggggctccttcagtgacgag
ggggccctgggcccagtgcagaccatctttgaccgcaccctggaccatgagtcattgaac
ccgggtgcccagaggtttgagaagatgattgggggtctgtacctgggtgagctggtgcgg
ctggtgctggctcacctggcccagcgtggggccctgtttggcggccacacctcccctgtc
ctgagaagccaaggcagcatcctcctggaacacgtggctgagatggaggatccctctgct
ggggcagcccgtgtgcacgctgtcctgcaggacttgggcctgaacccgaaggcctcagat
gctgagtgggtgcagtgtgtgtgcgtggctgtgtgcacgcgggccgcccagctctgcgct
gctgctctggccgctgtcctctcccgcctccagcacagccgggagcagcaggctcttcag
atcgccgtggctaccggaggccgagtgtttgagcgacaccccaggtttctcagtgtccta
cgggagacagtgatgctcctggcccccgactgcaatgtctctttcatcccctctgtggat
gggggtggccggggcgtggcaatggtgactgctgtggctgcccgcctggctgcccaccgg
cgcctgttggaggagaccttggcaccattccggttgacccgggagcagctggcagaagtg
caggcacagatgcgagaggccatggccaaggggctccaaggggaagcctcctccctccgc
atgctgcccacttatgtgcgggccacgcctgatggcagcgagcgtggggacttcctggcc
ctggacctggggggcaccaactttcgagtcctccttgtgcgtgtggccacgggaggtgtg
cagatctccagccagatctattccatcccggagtgcgtggcccagggctctggacagcag
ctctttgaccatattgtggactgcattgtggacttccagcagaagcagggcctgagtggg
cagagtctccccctgggtttcaccttctccttcccgtgcaggcagatgggcctggaccag
ggcatcctcctgaactggacaaagggtttcaatgcatctgactgcgagggccaagacgtt
gtgtgtctgctgcgggaagccatcaggcgccgacaggcagtggagctgaatgtggttgcc
attgtcaatgacacggtggggaccatgatgtcctgtggctacgaggacccccattgtgag
gtcggcctcatcgtcggaacaggcaccaatgcctgctacatggaggagctccggaatgtg
gccagtgtggatggggactcaggccagatgtgcatcaacacggagtggggcgcctttggg
gatgatggctctctcagcatgctcagcacccgatttgatgcctgtgtggaccaggcatcc
atcaatcctggcaagcagaggtttgagaagatgatcagtggcatgtacttgggagagatc
gtccgccacatcctcttgcatctgactagccttggagttctcttccggggccagcagacc
cagcgccttcagaccagggacatcttcaagaccaagtttctctctgagattgaaagtgat
agcctagccctgaggcaggtccgagccatcctggaggacctggggctgcccctgacctca
gacgatgctctgatggtcctggaggtgtgccaggctgtgtccaagagggctgcccagctt
tgtggggcaggcgtggctgccgtggtggagaagattcgtgagaaccggggcctggaagag
ctgaccatatccgtgggggtggatgggaccctctacaagctgcaccctcacttctccagc
ctggtggcagccacggtgcgggagctggcccctcgctgtgtggtcaccttcctgcagtca
gaggatgggtctggcaaaggtgcagccctggtcactgctgttgcctgccgccttgcccag
aggactcgagtctga

DBGET integrated database retrieval system