KEGG   Ovis aries (sheep): 101119602
Entry
101119602         CDS       T03117                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas01524  Platinum drug resistance
oas04064  NF-kappa B signaling pathway
oas04066  HIF-1 signaling pathway
oas04071  Sphingolipid signaling pathway
oas04115  p53 signaling pathway
oas04140  Autophagy - animal
oas04141  Protein processing in endoplasmic reticulum
oas04151  PI3K-Akt signaling pathway
oas04210  Apoptosis
oas04215  Apoptosis - multiple species
oas04217  Necroptosis
oas04261  Adrenergic signaling in cardiomyocytes
oas04340  Hedgehog signaling pathway
oas04510  Focal adhesion
oas04621  NOD-like receptor signaling pathway
oas04630  JAK-STAT signaling pathway
oas04722  Neurotrophin signaling pathway
oas04725  Cholinergic synapse
oas04915  Estrogen signaling pathway
oas04928  Parathyroid hormone synthesis, secretion and action
oas04933  AGE-RAGE signaling pathway in diabetic complications
oas05014  Amyotrophic lateral sclerosis
oas05022  Pathways of neurodegeneration - multiple diseases
oas05132  Salmonella infection
oas05145  Toxoplasmosis
oas05152  Tuberculosis
oas05161  Hepatitis B
oas05162  Measles
oas05168  Herpes simplex virus 1 infection
oas05169  Epstein-Barr virus infection
oas05170  Human immunodeficiency virus 1 infection
oas05200  Pathways in cancer
oas05206  MicroRNAs in cancer
oas05210  Colorectal cancer
oas05215  Prostate cancer
oas05222  Small cell lung cancer
oas05226  Gastric cancer
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101119602 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101119602 (BCL2)
   04630 JAK-STAT signaling pathway
    101119602 (BCL2)
   04064 NF-kappa B signaling pathway
    101119602 (BCL2)
   04066 HIF-1 signaling pathway
    101119602 (BCL2)
   04071 Sphingolipid signaling pathway
    101119602 (BCL2)
   04151 PI3K-Akt signaling pathway
    101119602 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101119602 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    101119602 (BCL2)
   04215 Apoptosis - multiple species
    101119602 (BCL2)
   04217 Necroptosis
    101119602 (BCL2)
   04115 p53 signaling pathway
    101119602 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101119602 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101119602 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101119602 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    101119602 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101119602 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    101119602 (BCL2)
   04722 Neurotrophin signaling pathway
    101119602 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101119602 (BCL2)
   05206 MicroRNAs in cancer
    101119602 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101119602 (BCL2)
   05226 Gastric cancer
    101119602 (BCL2)
   05215 Prostate cancer
    101119602 (BCL2)
   05222 Small cell lung cancer
    101119602 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101119602 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    101119602 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101119602 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101119602 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101119602 (BCL2)
   05152 Tuberculosis
    101119602 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101119602 (BCL2)
   05161 Hepatitis B
    101119602 (BCL2)
   05162 Measles
    101119602 (BCL2)
   05168 Herpes simplex virus 1 infection
    101119602 (BCL2)
   05169 Epstein-Barr virus infection
    101119602 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101119602 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101119602 (BCL2)
   01524 Platinum drug resistance
    101119602 (BCL2)
   01522 Endocrine resistance
    101119602 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oas01009]
    101119602 (BCL2)
Protein phosphatases and associated proteins [BR:oas01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101119602 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 101119602
NCBI-ProteinID: XP_011959221
UniProt: A0A6P3TG93
LinkDB
Position
23
AA seq 229 aa
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWEAGAAGAAPPGAAPAPGILSSQPGRAPAPS
RTSPPPPPAAAAGPAPSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRF
ATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHAWIQ
DNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
NT seq 690 nt   +upstreamnt  +downstreamnt
atggcgcacgcggggggcacaggctacgataaccgcgagatcgtgatgaagtacatccac
tacaagctgtcgcagcggggctacgagtgggaagccggagccgcgggcgccgcgcccccc
ggggccgcccccgcgccgggcatcctgtcctcccagcccggccgcgcgcccgcgccctcc
aggacctccccgccgccgcccccggccgccgccgccgggcctgcgcccagcccggtgcca
cctgtggtccacctgaccctgcgccaggccggcgatgacttctctcggcgctaccgccgc
gacttcgccgagatgtccagccagctgcacctgacgcccttcaccgcgaggggacgcttc
gccacggtggtggaggagctcttcagggacggggtgaactgggggcgcatcgtggccttc
tttgagttcggaggggtcatgtgtgtggagagcgtcaaccgggagatgtcgcccctggtg
gacagcatcgccctgtggatgaccgagtacctgaaccggcacctgcacgcctggatccag
gacaacggaggctgggacgcctttgtggagctgtatggccctagcatgcggcccctgttt
gatttctcctggctgtctctgaaggcactgctcagtctggccctggtgggcgcttgcatc
accctgggtgcctatctgggccataagtga

DBGET integrated database retrieval system