KEGG   Ovis aries (sheep): 101119631
Entry
101119631         CDS       T03117                                 

Gene name
UPK3A
Definition
(RefSeq) uroplakin-3a isoform X1
  KO
K19520  uroplakin-3a
Organism
oas  Ovis aries (sheep)
Pathway
oas05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09160 Human Diseases
  09162 Cancer: specific types
   05219 Bladder cancer
    101119631 (UPK3A)
Exosome [BR:oas04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101119631 (UPK3A)
SSDB
Motif
Pfam: PTP_tm SepQ
Other DBs
NCBI-GeneID: 101119631
NCBI-ProteinID: XP_027824005
Ensembl: ENSOARG00000019351
UniProt: A0A6P7DZ99
LinkDB
Position
3
AA seq 287 aa
MPPLWVVLALGCLRLGSGVNLQPQLASVTFATNNPTLTTVALEKPLCTFDSSAALHGTYE
VYLYVLVDSASFRNASVQDSTKTPLSSTFQQTKGGRTGPYKTAAFDLTPCSDSPSLDAVW
DVSRASEILNAYLIKVGTNGTCLSDPNFQGLCNPPLSAATEYRFKYVLVNMSSGLVQDQT
LWSDPIRTNRLTPYSAIDTWPGRRSGGMIVITSILGSLPFFLLIGFAGAIILSLVDRGDA
DGATSHDSQITQEAVPKSLGTSEPSYTSVNRGPPLDRAEVYASKLQD
NT seq 864 nt   +upstreamnt  +downstreamnt
atgcctccgctctgggtagtgctggccctgggctgcctgcgacttggctccggtgtgaac
ctccagccccaactggctagtgtgacctttgccaccaacaaccccaccctcaccacggtg
gccttggaaaagcccctctgcacgtttgacagctcagcggccctccatggcacctacgag
gtctacctctatgtgctggtcgactcagctagcttcaggaacgcctctgtgcaggacagc
accaagacccctctcagctcgacgttccagcagaccaagggggggaggacagggccctac
aagactgcggcctttgacttgaccccgtgcagcgactcgcccagcttggatgctgtctgg
gatgtgtcccgggcctcggaaatcctgaatgcctacctgatcaaggtgggcaccaacggg
acctgcctgtcggacccaaactttcagggcctctgcaacccacccctgtccgcagctacg
gagtacaggttcaagtatgtcctggtcaatatgtcctcgggcttggtacaggaccagacc
ctctggtcagaccccatccgcaccaaccggctcaccccatactcggcgatagacacgtgg
ccgggccggcggagcgggggtatgatcgtcatcacatccattctgggctccctgcccttc
ttcctgctcatcggctttgctggcgccatcatcctcagcctcgtggacaggggcgatgct
gacggggcaacaagccacgactcccagatcacgcaggaggctgtcccaaagtccctgggg
acctcggagccttcatacacgtctgtgaaccgggggccacccctggacagggccgaggtg
tatgccagcaagctccaggactga

DBGET integrated database retrieval system