KEGG   Ovis aries (sheep): 101119747
Entry
101119747         CDS       T03117                                 

Gene name
CDH1
Definition
(RefSeq) cadherin-1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
oas  Ovis aries (sheep)
Pathway
oas04015  Rap1 signaling pathway
oas04371  Apelin signaling pathway
oas04390  Hippo signaling pathway
oas04514  Cell adhesion molecules
oas04520  Adherens junction
oas05100  Bacterial invasion of epithelial cells
oas05200  Pathways in cancer
oas05213  Endometrial cancer
oas05216  Thyroid cancer
oas05218  Melanoma
oas05219  Bladder cancer
oas05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101119747 (CDH1)
   04390 Hippo signaling pathway
    101119747 (CDH1)
   04371 Apelin signaling pathway
    101119747 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101119747 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101119747 (CDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101119747 (CDH1)
  09162 Cancer: specific types
   05226 Gastric cancer
    101119747 (CDH1)
   05216 Thyroid cancer
    101119747 (CDH1)
   05218 Melanoma
    101119747 (CDH1)
   05219 Bladder cancer
    101119747 (CDH1)
   05213 Endometrial cancer
    101119747 (CDH1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101119747 (CDH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oas03036]
    101119747 (CDH1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:oas04515]
    101119747 (CDH1)
   04090 CD molecules [BR:oas04090]
    101119747 (CDH1)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    101119747 (CDH1)
Cell adhesion molecules [BR:oas04515]
 Cadherins
  Major cadherins
   101119747 (CDH1)
CD molecules [BR:oas04090]
 Proteins
  101119747 (CDH1)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro RET_CLD1 Cadherin_2
Other DBs
NCBI-GeneID: 101119747
NCBI-ProteinID: XP_027833919
Ensembl: ENSOARG00000003455
UniProt: A0A6P7EUK2
LinkDB
Position
14
AA seq 883 aa
MGPRCRNLSALLLLLQVSSWLCQEPEPCVPGFGAESYTFTVPRRNLERGRVLGRVSFEGC
TGLPRTVYVSDDTRFKVHTDGLVTVKRPVHLHRPELSFLVHAWDSTHRKLSTKVTLTVSA
HHHHHHRHHDSLSGTQTEVLTFPGSHHGLRRQKRDWVIPPISCPENEKGPFPKSLVQIKS
NREKETQVFYSITGQGADTPPVGVFIIERETGWLKVTQPLDREHIAKYILFSHAVSSNGQ
AIEEPMEIVITVTDQNDNKPQFTQEVFKGSVLEGALPGTSVMQVTATDIDDDVNTHNAAI
GYKILAQEPMLPHNKMFTINKETGVISVLTTGLDRESFPTYTLMVQAADLNGEGLSTTAT
AVITVLDTNDNAPRFDPTTYTGSVPENEANVAITTLTVTDADVPNTPAWEAVYTVLNDNE
KQFIVITDPVTNEGTLKTAKGLDFEAKQQYILYVAVTNVAPFEVTLPTSTATVTVDVIDV
NEAPIFVPPQKKVEVPEDFGVGLEITSYTAREPDTFMEQKIMYRIWRDAANWLEINPETG
AISTRAELDREDVEHVKNSTYTALIIATDNGSPPATGTGTLLLFLDDVNDNGPVPEPRAM
DFCQRNPEPHIINIVDPDLPPNTSPFTAELTHGASVNWTVEYNDQERESLILKPKKTLEV
GDHKINLKLIDNQNKDQVTTLDVHVCDCDGIVSNCRKPKAYAEAGLQVPAILGILGGVLA
FLILILLLLLLVRRRRVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDAR
PEVTRNDVAPTLMSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEGSG
SEAASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2652 nt   +upstreamnt  +downstreamnt
atgggccctcggtgccgcaacctctctgcgctcctgctgctgctgcaggtctcatcgtgg
ctctgccaggagccggagccctgcgtgcctggctttggcgctgagagttacacgttcacc
gtgccccggcggaacttggagagagggcgagtcctgggcagagtgagttttgaaggatgt
actggcctaccaaggacagtctatgtttctgacgacacccgattcaaagtgcacacagat
ggcctggttacagtcaaacggcctgtacaccttcatcgtccagagctaagttttcttgtc
catgcctgggactccacccacaggaagctctccaccaaagtgacactgacggtatcagcg
caccaccatcaccaccaccgtcatcatgactctctctctggaactcagacggaagtgctc
acatttcctggctcccaccatggtctccggagacagaagagagactgggtcattcctccc
atcagctgcccagaaaatgagaaaggcccatttcctaagtcgctggtccagatcaaatct
aacagggagaaagaaacccaagttttctacagcatcactggccaaggagctgacacaccc
cctgtcggtgtttttattattgaaagagaaacaggatggttaaaagtgacacagcctctg
gatagagaacacattgccaagtacattctcttctctcatgccgtatcttccaatggacaa
gccattgaagagcctatggagatcgtgatcacagtgaccgaccagaatgacaacaagccc
cagttcacccaggaggtcttcaaggggtctgtcctggaaggcgctcttccaggaacctct
gtgatgcaggtcacagccacagatatagatgatgacgtgaacacccacaatgctgccatc
ggttacaaaatcctagcccaagagcccatgctgccacacaacaaaatgttcaccatcaac
aaggaaacaggcgtcatcagtgtgctcaccaccgggctggaccgtgagagttttcccaca
tacaccctgatggtccaagcagcagaccttaatggcgaaggcttgagcacaactgcaacg
gccgtgatcacagtcctggacaccaatgataatgctcccagattcgacccgaccacgtac
acggggtcagtgcctgagaacgaggctaacgtggccatcaccacactcacagtgaccgat
gccgacgttcccaacaccccggcatgggaggctgtttacacagtattaaacgataatgag
aaacaatttatcgtcatcacagacccagtcaccaatgaaggcactctgaaaacagctaag
ggcttggattttgaggccaagcagcagtacatcctgtacgtggcagtgacgaatgtggcc
ccctttgaagtcactctccccacttccacagccacagtcactgtggatgtgatcgatgtg
aatgaagcccccatctttgtgcctcctcaaaagaaagtggaagtgcctgaggactttggc
gtgggcctggagatcacatcctataccgcccgggagccagacacatttatggaacagaag
atcatgtatcggatttggagggacgctgccaactggctggagattaatccggaaacgggt
gccatttccactcgggctgagttggacagagaggatgtagagcatgtgaagaacagcacg
tacacagccctcatcatagccactgacaacggatctccacctgccactgggacaggcacc
ctgctcctgttcctcgatgatgtgaatgacaatggccccgtaccagaaccccgggccatg
gacttctgccagaggaatcccgagcctcacatcatcaacatcgtggatcctgatctcccc
ccgaacacctcccccttcacagcagaactgacacatggggcgagtgtcaactggaccgtt
gagtacaatgaccaagaacgtgagtctctgattttgaagccaaagaaaaccttagaggtg
ggtgaccacaaaatcaatctcaagctcatagacaaccagaacaaagaccaggtgactaca
cttgatgtgcacgtatgtgactgtgatgggatcgtcagcaactgcaggaagcccaaggcc
tatgccgaagcaggattgcaagttcccgccatcctggggatcctcggaggcgtccttgct
tttctgatccttattctgctgcttctgctacttgttcggaggagaagggtggtcaaagag
cccttactgcccccagaagacgacacccgggacaatgtgtattactatgatgaagaagga
ggtggagaagaagaccaggactttgacttgagccagttacataggggcctggatgctcgt
cctgaagtgactcgcaatgacgtggcaccaaccctcatgagtgtgccccagtaccgaccc
cgccctgccaatcctgatgaaattggaaactttattgatgaaaacctgaaggcagctgat
agtgaccccactgccccaccctatgactctctgctggtgtttgattatgaaggaagtggt
tccgaagctgctagtctgagctccctgaactcctcagagtcagaccaagaccaggactat
gactacctgaatgaatggggcaatcgcttcaagaagctggcggacatgtatggaggcggc
gaggatgactaa

DBGET integrated database retrieval system