KEGG   Ovis aries (sheep): 101119850Help
Entry
101119850         CDS       T03117                                 

Gene name
ACADS
Definition
(RefSeq) short-chain specific acyl-CoA dehydrogenase, mitochondrial
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas00071  Fatty acid degradation
oas00280  Valine, leucine and isoleucine degradation
oas00410  beta-Alanine metabolism
oas00640  Propanoate metabolism
oas00650  Butanoate metabolism
oas01100  Metabolic pathways
oas01200  Carbon metabolism
oas01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    101119850 (ACADS)
   00650 Butanoate metabolism
    101119850 (ACADS)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101119850 (ACADS)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101119850 (ACADS)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101119850 (ACADS)
Enzymes [BR:oas01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     101119850 (ACADS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 HpaB_N
Motif
Other DBs
NCBI-GeneID: 101119850
NCBI-ProteinID: XP_027812426
Ensembl: ENSOARG00000013118
LinkDB All DBs
Position
17
AA seq 412 aa AA seqDB search
MAATLLARACGLVRGAPWPWGWRRLHTVYQSVELPETHQMLRQTCRDFAEKELFPIAAQV
DKEHRFPAAQVKKMGELGLMAMDVPEELGGAALDYLAYSIAMEEISRGCASTGVIMSVNN
SLYLGPILKFGTKEQKQRWVTPFTSGEKIGCFALSEPGNGSDAGAAATTARADGDSWVLS
GTKAWITNAWEASAVVVFASTDRSLYNKGISAFLVPMPTPGLTLGKKEDKLGIRASSTAN
LIFEDCRIPKDSLLGEPGLGFKIAMQTLDMGRIGIASQALGIAQAALDCAVSYAENRSAF
GAPLTKLQGIQFKLADMALALESARLLTWRAAMLKDNKKPFTKEAAMAKLAASEAATAIT
HQAMQILGGMGYVTEMPAERHYRDARITEIYEGTSEIQRLVVAGHLLKSYRS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggctgccacgctgctcgcccgggcctgtggccttgtccgcggagccccctggccttgg
ggctggcgtcgcctacataccgtctaccagtctgttgaactgcccgagactcaccagatg
ctgcggcagacgtgccgcgactttgccgagaaggagctctttcccatagcagcccaggtg
gacaaggagcatcgcttcccagcagctcaggtgaagaagatgggcgagctggggctcatg
gccatggatgtgcccgaggagctcggcggagccgccctcgattacctggcctactccatc
gccatggaggagatcagccggggctgcgcctccacgggagtcatcatgagtgtcaacaat
tccctctacttagggcccatcctgaagttcggcaccaaggagcagaagcagcggtgggtc
actcccttcactagtggcgagaagatcggctgcttcgccctcagtgaaccagggaacggc
agcgatgcaggggccgcggccaccaccgcgcgggcagacggtgactcgtgggtcctgagt
ggcaccaaggcctggatcaccaacgcctgggaggcctcagccgtcgtggtcttcgccagc
accgacagatccttgtataacaagggcatcagtgccttcctggtccccatgcccacaccc
gggctcacgctggggaagaaggaagacaagctgggcatccgggcctcgtccacggccaac
ctcatcttcgaggactgtcgcatccccaaggacagcctgctgggggagccggggctgggc
ttcaagatcgccatgcaaaccctggacatgggccgcatcggcatcgcctcccaggccctg
ggcatcgcccaggccgccctggactgtgctgtgagctacgctgagaaccgcagtgctttc
ggggcgcccctcaccaagctgcagggcatccagttcaagttggcggacatggccctggcc
ctggagagtgcccggctgctgacctggcgcgctgccatgctgaaggacaacaagaagcct
ttcaccaaggaggcggcaatggccaagctggctgcatcggaggccgcaactgccatcacc
caccaggccatgcagatcctgggcggcatgggctacgtgacggagatgccggcggagcgg
cactaccgcgacgcccgcatcacagagatttatgagggcaccagtgagatccagaggctg
gtggtcgccgggcacctgctcaagagctaccggagctga

DBGET integrated database retrieval system