KEGG   Ovis aries (sheep): 101120216
Entry
101120216         CDS       T03117                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
oas  Ovis aries (sheep)
Pathway
oas05164  Influenza A
oas05171  Coronavirus disease - COVID-19
oas05202  Transcriptional misregulation in cancer
oas05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101120216 (TMPRSS2)
  09162 Cancer: specific types
   05215 Prostate cancer
    101120216 (TMPRSS2)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101120216 (TMPRSS2)
   05164 Influenza A
    101120216 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:oas01002]
    101120216 (TMPRSS2)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     101120216 (TMPRSS2)
Peptidases and inhibitors [BR:oas01002]
 Serine peptidases
  Family S1: chymotrypsin family
   101120216 (TMPRSS2)
SSDB
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 Trypsin_2 SRCR Ldl_recept_a
Other DBs
NCBI-GeneID: 101120216
NCBI-ProteinID: XP_027816505
Ensembl: ENSOARG00000010334
UniProt: A0A6P7DCT1
LinkDB
Position
1
AA seq 490 aa
MALNSGSSPGVGPYYENHGYQPESLYPRQLPTAPPAYQVYPAQYYPPMVPQYTPRVQTHA
STPVIYRQPKPPSRTACTSKTKKALCITFTLAALLTGAILAAVLLWKYMEDGCSGMECGS
SGTCVSPSLWCDGILHCPGGEDENRCVRLYGPNFILQVYSAQRKSWHPVCQDNWSESYGR
AACQDMGYRNSFYSSQGIADDSGATSFMKLNISANNIDLYKKLYHSDVCSSKTVVSLRCI
ECGVAVKTSRQSRIVGGSNANSGEWPWQVSLHVQGIHVCGGSIITPEWIVTAAHCVEEPL
NNPKIWAAFAGILKQSYMFYGSGYRVAKVISHPNYDSKTKNNDIALMKLQKPLTFNDKVK
PVCLPNPGMMLEPTQSCWISGWGATYEKGKTSDDLNAAKVHLIEPRKCNSKYMYDNLITP
AMICAGYLQGTVDSCQGDSGGPLVTLKSSVWWLIGDTSWGSGCAKAYRPGVYGNVTVFTD
WIYRQMRANS
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggctttaaactcaggatcatcaccaggtgtcgggccttactatgagaaccatggatac
cagccggaaagcttgtaccctcggcagctgcccacggctccccctgcctaccaggtgtac
cccgctcagtactacccgcctatggtgccccagtacaccccaagggttcagacgcacgcc
tcgacacctgtaatctacaggcagcccaaacctccgtccaggacagcgtgcacctcaaag
accaagaaagccctgtgcatcaccttcaccctggcagccctgctgacaggagcaatcctc
gctgccgtcctcctctggaagtacatggaggacgggtgctcagggatggagtgcggctcc
tccgggacctgtgtcagcccctccctctggtgcgatggcatcctgcactgccccggtggc
gaggacgagaaccgctgcgttcgcctctatggaccgaacttcatccttcaggtgtactca
gcacagaggaagtcctggcaccccgtgtgccaggacaactggagtgagagctacgggagg
gcggcctgccaggacatgggctaccggaatagtttttattctagccaaggaatagcagat
gacagcggagccacaagctttatgaagctgaacataagtgccaacaatatcgatctctat
aaaaaactctaccacagcgatgtctgttcttcaaaaacagtggtttctttacgctgtata
gaatgcggggtcgccgtgaagacgagtcgccagagccggatcgtggggggatcgaatgct
aactcgggcgaatggccctggcaggttagcctgcacgtgcagggcatccacgtctgcggg
ggctccatcatcaccccggagtggatcgtgacagccgcgcactgtgtagaggaacctctt
aacaatcccaagatatgggcggcctttgcgggaatcttgaaacaatcttacatgttctat
ggaagtggataccgagtagcaaaagtgatttcccacccaaattatgattccaagaccaag
aacaatgacatcgctctaatgaagctgcagaagcctctgactttcaacgacaaagtgaag
ccagtgtgtctgcccaatccaggcatgatgctggagccaactcagtcctgctggatttct
gggtggggggccacctacgagaaagggaagacctcggatgacctgaatgcggccaaggtg
cacctcattgagccccggaagtgcaacagcaagtacatgtacgacaacctcatcacgccc
gccatgatctgtgcaggctacctgcagggcaccgtcgactcctgccagggtgacagtgga
ggtcctctggtcacactgaagagcagtgtctggtggctgatcggagacacgagctggggg
tcgggctgtgccaaggcgtaccgaccgggagtgtacgggaatgtgacagtgttcacagac
tggatctatcgacaaatgagggcaaacagctaa

DBGET integrated database retrieval system