KEGG   Ovis aries (sheep): 101120216Help
Entry
101120216         CDS       T03117                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease serine 2 isoform X1
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
oas  Ovis aries (sheep)
Pathway
oas05164  Influenza A
oas05202  Transcriptional misregulation in cancer
oas05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    101120216 (TMPRSS2)
  09162 Cancers: Specific types
   05215 Prostate cancer
    101120216 (TMPRSS2)
  09172 Infectious diseases: Viral
   05164 Influenza A
    101120216 (TMPRSS2)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     101120216 (TMPRSS2)
Peptidases [BR:oas01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101120216 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 DUF1986 Hepsin-SRCR Trypsin_2 SRCR Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 101120216
NCBI-ProteinID: XP_011959386
Ensembl: ENSOARG00000010334
LinkDB All DBs
Position
1
AA seq 490 aa AA seqDB search
MALNSGSSPGVGPYYENHGYQPESLYPRQLPTAPPAYQVYPAQYYPPMVPQYTPRVQTHA
STPVIYRQPKPPSRTACTSKTKKALCITFTLAALLAGAILAAVLLWKYMEDGCSGMECGS
SGTCVSPSLWCDGILHCPGGEDENRCVVRPPGASFVLVFGQDEGHGLPVCQDNWSESYGR
AACQDMGYRNSFYSSQGIADDSGATSFMKLNISANNIDLYKKLYHSDVCSSKTVVSLRCI
ECGVAVKTSRQSRIVGGSNANSGEWPWQVSLHVQGIHVCGGSIITPEWIVTAAHCVEEPL
NNPKIWAAFAGILKQSYMFYGSGYRVAKVISHPNYDSKTKNNDIALMKLQKPLTFNDKVK
PVCLPNPGMMLEPTQSCWISGWGATYEKGKTSDDLNAAKVHLIEPRKCNSKYMYDNLITP
AMICAGYLQGTVDSCQGDSGGPLVTLKSSVWWLIGDTSWGSGCAKAYRPGVYGNVTVFTD
WIYRQMRANS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggctttaaactcaggatcatcaccaggtgtcgggccttactatgagaaccatggatac
cagccggaaagcttgtaccctcggcagctgcccacggctccccctgcctaccaggtgtac
cccgctcagtactacccgcctatggtgccccagtacaccccaagggttcagacgcacgcc
tcgacacctgtaatctacaggcagcccaaacctccgtccaggacagcgtgcacctcaaag
accaagaaagccctgtgcatcaccttcaccctggctgccctgctggcaggagcaatcctc
gctgccgtcctcctctggaagtacatggaggacgggtgctcagggatggagtgcggctcc
tccgggacctgtgtcagcccctccctctggtgcgatggcatcctgcactgccccggtggc
gaggacgagaaccgctgcgtggtgagaccacctggtgcatcttttgttctggtatttggc
caggatgaaggtcacggtctccccgtgtgccaggacaactggagtgagagctacgggagg
gcggcctgccaggacatgggctaccggaatagtttttattctagccaaggaatagcagat
gacagcggagccacaagctttatgaagctgaacataagtgccaacaatatcgatctctat
aaaaaactctaccacagcgatgtctgttcttcaaaaacagtggtttctttacgctgtata
gaatgcggggtcgccgtgaagacgagtcgccagagccggatcgtggggggatcgaatgct
aactcgggcgaatggccctggcaggttagcctgcacgtgcagggcatccacgtctgcggg
ggctccatcatcaccccggagtggatcgtgacagccgcgcactgtgtagaggaacctctt
aacaatcccaagatatgggcggcctttgcgggaatcttgaaacaatcttacatgttctat
ggaagtggataccgagtagcaaaagtgatttcccacccaaattatgattccaagaccaag
aacaatgacatcgctctaatgaagctgcagaagcctctgactttcaacgacaaagtgaag
ccagtgtgtctgcccaatccaggcatgatgctggagccaactcagtcctgctggatttct
gggtggggggccacctacgagaaagggaagacctcggatgacctgaatgcggccaaggtg
cacctcattgagccccggaagtgcaacagcaagtacatgtacgacaacctcatcacgccc
gccatgatctgtgcaggctacctgcagggcaccgtcgactcctgccagggtgacagtgga
ggtcctctggtcacactgaagagcagtgtctggtggctgatcggagacacgagctggggg
tcgggctgtgccaaggcgtaccgaccgggagtgtacgggaatgtgacagtgttcacagac
tggatctatcgacaaatgagggcaaacagctaa

DBGET integrated database retrieval system