KEGG   Ovis aries (sheep): 101120258
Entry
101120258         CDS       T03117                                 

Gene name
EXO1
Definition
(RefSeq) exonuclease 1
  KO
K10746  exonuclease 1 [EC:3.1.-.-]
Organism
oas  Ovis aries (sheep)
Pathway
oas03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    101120258 (EXO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oas03032]
    101120258 (EXO1)
   03400 DNA repair and recombination proteins [BR:oas03400]
    101120258 (EXO1)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     101120258 (EXO1)
DNA replication proteins [BR:oas03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    101120258 (EXO1)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     101120258 (EXO1)
SSDB
Motif
Pfam: XPG_I XPG_N XPG_I_2
Other DBs
NCBI-GeneID: 101120258
NCBI-ProteinID: XP_027831386
Ensembl: ENSOARG00000007232
LinkDB
Position
12
AA seq 839 aa
MGIHGLLQFIKEASEPIHMRKYKGQVVAVDTYCWLHKGAVACAEKLAKGEPTDKYVGFCM
KFVNMLLSHGIKPILVFDGCTLPSKKEVEKSRRERRQANLLKGKQLLREGKVSEARECFT
RSINITHTMAHNVIKAARSQGVDCLVAPYEADAQLAYLNKAGIVQAVITEDSDLLAFGCK
KVILKMDQFGNGLEVDQARLGMCKQLGDVFTEEKFRYMCILSGCDYLSSLRGIGLAKACK
LLRLANNPDILKVIRKIGHYLKMNITVPEDYIKGFIRANNTFLYQLVFDPIERKLIPLNA
YEDDVDPKTLSYAGQYVDDSIALQIALGNKDINTLEQIDDYNPDTAMLAQSRSHSWTDRA
CQKSSNINSIWHRNYCPRRELNIVSDTTKVKENPSTVGIKQVISTKGLNLPRKSSIVKRP
RSEELSEDDMMDQYSTSFTKKIKNNSCEGNKSLKSSELFMPDLVDGTTIKKSLSTPPTTR
NKFATFLQRKNEESGAVVVPGTRSRYFCLVFSNSLDSADCISKKASSQPLAETAVTDKET
DAGEPDCLEDKKLGDTSVSHNSSEQTPDGVTVMAEESQSFKTSAFTRTISPPTLGTLRSC
FSWSGSLGDISRTPSPSPSTALQQFRRKSDSSTSLPENIEMSDVAPLKSDESSDESHPLH
DVGCFSQSQESMDLSPHNLNASKLSQPSSKDSDSEESDCNFKSLDKQGNQKSKLHLFDFS
KKDTLLRNKIPGLYKSSSVDSLSTTKIKPLVPARASGLSKKPSSIHKRNHHNAENKPGLQ
IKINELWKNFVFKKDSEKLPSCKKPDPLSPVKDNIQLTPEEEDIFNNSECMLVQRALFQ
NT seq 2520 nt   +upstreamnt  +downstreamnt
atggggatacatggattgctgcaatttatcaaagaagcttctgaacctatccacatgagg
aagtataaagggcaggtggtagctgtggatacatattgctggcttcacaaaggagctgtt
gcttgtgcagaaaagctagccaaaggtgaacctactgataagtatgtaggattttgtatg
aaatttgtaaatatgttactatctcatgggatcaagcctatcctggtatttgatggatgt
actttaccttctaaaaaggaagtggaaaaatctagaagagaaagacgacaagccaatctc
cttaagggaaagcagcttcttcgtgaagggaaggtctcggaagccagagaatgtttcaca
cgttctatcaatatcacacatactatggcccacaacgtaattaaagctgctcggtctcag
ggagtagattgtcttgtggctccatatgaagcagatgcacagctggcctatcttaacaag
gctggcattgtacaagctgtcattacggaggactctgatcttcttgcttttggctgtaaa
aaggttattttaaaaatggaccagtttggaaatggactagaagttgatcaggctcgtctg
ggaatgtgcaaacagcttggggatgtgttcacagaagagaagttccgttacatgtgcatt
ctttcaggctgtgactatctttcatcactgcgtgggattggattagccaaggcctgcaaa
ctactaagactagccaataatccagatattttaaaggtcatcaggaaaattggacattat
ctcaagatgaacataacagtaccagaagattacatcaaaggatttattcgggccaacaat
accttcctctatcagctagtttttgatcccatcgaaaggaaactcatccctctgaatgcc
tatgaagatgatgttgatcccaaaacactaagctatgctgggcaatatgttgatgattcc
atagctcttcaaatagcacttgggaataaagatataaatactctcgagcagattgatgac
tacaatccagacactgccatgcttgcccaatcaagaagtcatagttggactgacagagca
tgtcaaaaatcatctaatattaatagcatttggcataggaattattgccctagacgtgaa
ctgaatattgtttcagatactacaaaggtgaaggaaaatccaagtactgtgggcattaaa
caagtgattagtactaaagggttaaatcttccaaggaagtcatccattgtaaaaagacca
agaagtgaagagctgtcagaagatgatatgatggatcaatattctacttcctttacaaag
aagatcaagaataatagttgtgaaggtaacaagtcattgaaatcttctgaactatttatg
cctgacctggtagatggaactactattaaaaaaagcttaagcacaccacctacgacaaga
aacaaatttgcaacgtttttacagagaaaaaatgaagaaagtggtgcagttgtggttcca
ggcaccagaagcaggtatttttgtctagttttttccaattctctggattctgctgactgt
atatcaaagaaagcaagcagccagcctctagctgaaactgctgtcacagataaagaaacc
gatgcaggtgaaccagattgtctagaggacaagaagttgggtgataccagtgtatcgcat
aattccagtgagcagactccagatggtgtgactgtgatggctgaagagtctcagtctttt
aagaccagcgcattcacgaggaccatctcaccacccaccttggggacactaagaagttgt
ttcagttggtctggaagtcttggagatatttcaagaactccaagcccctctccaagcaca
gcattgcagcagttccgtagaaagagtgattcttccacctctctgcctgagaatattgag
atgtctgatgtagctccgttaaagagtgatgagtcaagtgatgaatcacatcccttacat
gacgtgggttgcttctcacagtctcaggaaagcatggacttgtcaccacacaatttaaat
gcatcaaaactttctcagccttctagtaaggattcagattcagaggaatctgattgcaat
tttaagtcacttgataaacaaggtaatcagaaatccaagctacacttgtttgatttttca
aagaaagacacgcttctaagaaacaagattcctgggctgtataaatccagttctgtggac
agtctttctacaaccaagatcaaacctttagtacctgccagagccagtgggctgagcaag
aagccatcaagcatccataagagaaatcatcacaatgccgaaaacaagccaggactgcag
atcaaaatcaatgaactctggaaaaattttgtatttaaaaaagattctgaaaagcttcct
tcttgtaagaagccagatcccctgtctccagtcaaagataacatccagctaactccagaa
gaagaggatatatttaacaattctgaatgtatgcttgttcagagagcactattccagtaa

DBGET integrated database retrieval system