KEGG   Ovis aries (sheep): 101120372Help
Entry
101120372         CDS       T03117                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: inactive pancreatic lipase-related protein 1
  KO
K14074  pancreatic lipase-related protein 1 [EC:3.1.1.3]
Organism
oas  Ovis aries (sheep)
Pathway
oas00561  Glycerolipid metabolism
oas01100  Metabolic pathways
oas04972  Pancreatic secretion
oas04975  Fat digestion and absorption
Module
oas_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    101120372
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    101120372
   04975 Fat digestion and absorption
    101120372
Enzymes [BR:oas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     101120372
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase PLAT Palm_thioest Abhydrolase_6 DUF900 Abhydrolase_3
Motif
Other DBs
NCBI-GeneID: 101120372
NCBI-ProteinID: XP_027816137
LinkDB All DBs
Position
22
AA seq 393 aa AA seqDB search
MVSIWTVALLLLGAAKGNEVCHDSIRYVSDSEPWAGTAIRPLKILPWSPEKIGTHFLLYT
NKNPNNVQVISSDPSTIEASSFQIAKKTRFIIHGFIDKGDESWLVHMCKNMFEVEEVTCI
CVDWKKGSQTXYTQATNNVRVVGAQTAQMLAMLKSNHSYSPSQVHLIGHSLGAHAAGEAG
RKTPGLGRITGTRDFVVCNHLRSXKYYSESILNPSGLSAYPCACYRDFESNKCFPFPGEG
CPADGMLCXRFAGKTREEQQKFFLNTGDSSKFARWRYGVSITLSGRTATGQIKVALFGNK
GNTCQYNVFNGIIKPGSTLSSEFNGDIDVGTIEKVKFLWNNNVANPTLPKVGAAKIAVQK
GEEKTEEAHSFCSKTVPCHDTVREDVLLTLMPC
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggtgagcatctggacagttgctcttttgctgctgggagcagccaaaggaaacgaagtt
tgccatgattctatcaggtatgtctctgactctgagccctgggctgggactgcaatcagg
cccttgaaaattctcccctggagcccggagaagattggcacccacttcctgctctacacc
aacaaaaatccaaacaacgttcaagtgatttcctctgatccatcaacgattgaggcatcc
agtttccaaatagccaagaagacccggttcatcatccatggcttcatcgacaagggagat
gagagctggctggtgcacatgtgcaagaacatgtttgaggtggaggaggtgacctgcatc
tgcgtggactggaagaaaggctcccagacancttacactcaggccaccaacaatgtgcgc
gtggtgggcgcccagacggcccagatgctggccatgctcaagtcaaaccacagctactca
ccttcccaagtccacctcattggccacagcctgggggcccatgcggcaggagaggcaggg
agaaaaactccaggcctgggcaggattacaggaacccgggacttcgtggtttgcaatcac
ttgagaagcnaaaagtactactcagagagcatcctcaatcccagtggactcagcgcatac
ccctgtgcttgctacagggactttgagtctaacaagtgcttcccctttccgggtgaaggg
tgtcccgcagatgggatgctatgcntgagatttgctggcaagacacgtgaggagcagcag
aaattcttcctgaacacaggagattccagcaaatttgcccgctggagatatggcgtttct
ataacactgtctggaagaacagccactggtcaaatcaaagttgctttgtttggaaataag
ggaaacacttgtcaatacaatgtcttcaatgggattatcaaaccaggctccaccctttcc
agtgaatttaatggcgatattgatgttggaacaattgagaaagtcaagtttctttggaat
aacaacgtggcaaacccaaccctcccgaaagtaggtgcagccaagatcgccgtgcagaag
ggagaggagaagacagaggaagcacacagtttctgcagcaaaactgtcccatgtcatgac
accgtgagagaagacgtcctgctcactctcatgccctgttaa

DBGET integrated database retrieval system