KEGG   Ovis aries (sheep): 101120493Help
Entry
101120493         CDS       T03117                                 

Gene name
TMPRSS9
Definition
(RefSeq) LOW QUALITY PROTEIN: transmembrane protease serine 9 isoform X1
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
oas  Ovis aries (sheep)
Brite
KEGG Orthology (KO) [BR:oas00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:oas01002]
    101120493 (TMPRSS9)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     101120493 (TMPRSS9)
Peptidases [BR:oas01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101120493 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986 Ldl_recept_a SEA
Motif
Other DBs
NCBI-GeneID: 101120493
NCBI-ProteinID: XP_014951149
Ensembl: ENSOARG00000013786
LinkDB All DBs
Position
5
AA seq 1136 aa AA seqDB search
MEPTASDLRLGPGAPQENLASDEVCCRTALSTLVATSIILVTLGVLVASLSTQGVEVEHT
AELRGIRFAPSLQQETSEYYRTLTPALEMLFVSSFQETELESSCVGCTVLSYWEGNASVL
VRFRLHFLLLALWTPSPGLEEQLLQRGLHARLQGPGIPLASYGTIVSAQLTGSQKGPLTE
RDLKSGRCPGNAFSCGNSQCVTKMNPECDDTADCSDGSDEAHCDCGLQPGWKTAGRIVGG
VEASPGEFPWQVSLRENNEHFCGAAIISARWLVSAAHCFNEFQDSPEWVAYVGTTYLSGS
EASTVRAHVARIITHPSYNSDTADFDVAVLELGRALPFSRHVQPVCLPAASHVFPPRKKC
LISGWGYLKEDFLVKPEMLQKATVELLDQALCASLYGHSLTDRMVCAGYLDGKVDSCQGD
SGGPLVCEESSGRFFLAGIVSWGIGCAEAQRPGVYARVTSLRDWILETIATASKPPAPTV
ALASTTLSTAWPTSPKSLVTDTLIKPTLAPSTVPLDLATASKPQGCGARPAREKPTRIVG
GLGASLGEVPWQVSLKEGSRHFCGATVVGDRWLLSAAHCFNHTKVELVRAQLGTASLSGV
GGSPVKVGLRRVVLHPQYNPSILDFDVAVLELARPLVFNKYVQPVCLPLAIQKFPVGRKC
LISGWGNTQEGNATKPDLLQRASVGIIDHKACSALYNFSLTDRMICAGFLEGKVDSCQGD
SGGPLACEETPGVFYLAGIVSWGIGCAQVKKPGVYTRITRLKGWILATMSSHSLPTAPLP
TTRMPTSSHTRTTAGLTVPGVTASTPTPRATLTTPTPPATIRVTSQPANRTTAAATSTPR
GQTPLPPTLKTTVGAQLPGTWGDGAARVGGGLLCLSWGCIIVAQQAADGVKWTKVVAPLC
RHLQHSQAGLHGGTGQLAWRRRGPPREHRCGAVLVAERWLLSAAHCFDVYGDPKQWAAFL
GTPFLSGADGQLERVARIHKHPFYNLYTLDYDVALLELVGPVRRSRLVRPICLPEPAPRP
PDGARCVITGWGSVREGGSMARQLQKAAVRLLSEQTCRRFYPVQISSRMLCAGFPQGGVD
SCSGDAGGPLACREPSGRWVLTGVTSWGYGCGRPQFPGVYTRVAAVRGWIGQNIQE
NT seq 3411 nt NT seq  +upstreamnt  +downstreamnt
atggagcccactgccagtgacttacggctggggcctggagcaccccaagaaaacctggct
tcagatgaagtgtgctgccggacggccctctccactctcgtggccaccagcatcatcctc
gtcaccctgggagtccttgtggcctccctctccacacagggcgtcgaggtagagcacacg
gctgagctgcgtgggatccggtttgcccccagcttgcagcaggagacctcagagtactac
cgcacgctcacgcccgctctggaaatgctgtttgtcagcagctttcaagagacagagttg
gagtccagctgcgtgggctgcacagtgctgagttactgggagggcaacgccagcgtcctg
gtgcgtttccggctgcactttctgctgctggctctgtggacgccgagcccaggcctggag
gagcagctattgcagcggggacttcatgcgaggctgcagggccctggcatccccctggcc
tcctatggcaccattgtgtctgcccagctcacaggaagccagaaggggccactgacagaa
agagacttaaaatcaggccgctgtccagggaatgccttttcctgcgggaacagccagtgc
gtgaccaagatgaacccggagtgcgatgacacagccgactgctccgacggctccgacgag
gcccactgcgactgtggcttgcagcctggctggaagacagccggcaggattgtgggtggt
gtggaagcgtccccaggggagttcccttggcaagtcagcctccgtgaaaacaacgaacac
ttctgtggggccgccatcatcagcgccaggtggctggtgtctgctgcccactgcttcaac
gaattccaggactccccggagtgggtggcttacgtgggcaccacctacctcagcggctca
gaagccagcacggtgcgggcccacgtggcccggatcatcacacacccatcctacaactcg
gacacagctgacttcgacgtggcggtgctggagctgggcagagccctgcccttcagccgg
catgtgcagcccgtgtgcctgccggccgcctcgcacgtcttcccaccaaggaagaagtgc
ctcatctcaggctggggctacctcaaggaggacttcctggtcaagccggaaatgctgcag
aaggccactgtggagctgctggaccaggccctgtgcgccagcctatacggccactcactc
accgacaggatggtgtgcgctggctacctggacgggaaggtggactcctgccagggtgac
tcagggggccccctagtctgcgaggagtcctctggcaggttcttcctggctggcatcgtg
agctggggaatcggctgtgcggaagcccagcgtccgggggtctatgcccgagtgaccagt
ctgcgggactggatcctggagaccatcgctactgcaagcaagcctccagcccccacggtg
gctctcgcctccaccactctcagcactgcctggcccaccagccccaagagcctggtgact
gacaccctcatcaaacccacactggcccctagcactgtgcctctcgacttggccaccgct
tctaagccacaagggtgtggggccaggccggcgcgggagaagcccacccggatcgtgggg
gggcttggggcctccttgggggaggtgccctggcaggtcagcctgaaggagggctcgcgg
cacttctgcggagccaccgtggtgggggaccgctggctgctgtctgccgcccactgcttc
aaccacacgaaggtggagctggtgcgggcccagctgggcaccgcgtccctgtcgggcgtt
ggtgggagccccgtgaaggtggggctcaggcgggtggtgctgcacccccagtacaacccc
agcatcctggacttcgacgtggccgtgctggagctggccaggcctttggtcttcaacaag
tatgtgcagcccgtctgcctgccgctggccatccagaagttccctgtgggccgcaagtgt
ctgatctccgggtggggcaacacccaagagggcaacgccaccaagcctgaccttcttcag
cgggcatctgtgggcatcatagaccacaaggcgtgtagcgccctctacaacttctcgctc
acagacaggatgatctgcgccggcttcctggagggcaaggtggactcctgccagggtgac
tctgggggacccctggcctgtgaggagacacctggtgtgttttatctggctgggatcgtg
agctggggcatcggctgtgcacaggtcaagaagccgggtgtgtatacccgcatcaccagg
ctcaagggctggatcctggccaccatgtcctcccactcgctccccacagccccgctgccc
accacaaggatgcccaccagcagtcacaccaggacgacagcaggcctcacagtcccggga
gtcacggccagcacacccactccccgggccaccctcacaacacccactcccccagccacc
atcagggtgaccagtcaacctgccaacaggaccaccgctgctgcgacctccactcctagg
ggccagacaccactgcccccaactctgaagaccacggtgggcgcccagctaccaggtacc
tggggagatggagcggcacgtgtgggtggcgggttattgtgtctgtcatggggctgcatc
attgtggcccagcaagctgcagatggggtcaagtggaccaaggtggtggcccccctctgt
cgccacctccagcacagccaggcagggctccatggtgggacgggacagttggcatggagg
aggcgcgggcccccgcgggagcaccgctgcggggctgtgctggtggcggagaggtggctg
ctgtcggcggcgcactgcttcgacgtctacggggaccccaagcagtgggcagccttcctg
ggcacgccgttcctgagtggcgctgacgggcagctggagcgtgtggcgcgcatccacaag
caccccttctacaacctctacaccctcgactacgacgtggcactgctcgagctagtgggg
ccagtacgccgcagccgcctggtgcggcccatctgcctgcctgagcccgccccgcggccc
cccgacggtgcgcgctgcgtcatcacaggctggggctccgtgcgcgagggaggctcgatg
gccaggcagctgcagaaggcggccgtgcgcctcctcagcgagcagacctgccgccgcttc
tacccggtacagatcagcagccgcatgctgtgcgccgggttcccgcagggaggcgtggac
agctgctcgggtgacgcggggggacccctggcctgcagggagccctccggccgctgggtg
ctaactggggtcaccagctggggttacggctgtgggcggccccagttcccgggcgtgtat
acccgggtggctgctgtcagaggctggatcgggcagaacatccaggagtga

DBGET integrated database retrieval system