KEGG   Ovis aries (sheep): 101120874
Entry
101120874         CDS       T03117                                 

Gene name
GSTP1
Definition
(RefSeq) glutathione S-transferase P
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
oas  Ovis aries (sheep)
Pathway
oas00480  Glutathione metabolism
oas00980  Metabolism of xenobiotics by cytochrome P450
oas00982  Drug metabolism - cytochrome P450
oas00983  Drug metabolism - other enzymes
oas01100  Metabolic pathways
oas01524  Platinum drug resistance
oas05200  Pathways in cancer
oas05204  Chemical carcinogenesis
oas05215  Prostate cancer
oas05225  Hepatocellular carcinoma
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101120874 (GSTP1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101120874 (GSTP1)
   00982 Drug metabolism - cytochrome P450
    101120874 (GSTP1)
   00983 Drug metabolism - other enzymes
    101120874 (GSTP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101120874 (GSTP1)
   05204 Chemical carcinogenesis
    101120874 (GSTP1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101120874 (GSTP1)
   05215 Prostate cancer
    101120874 (GSTP1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101120874 (GSTP1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101120874 (GSTP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:oas02000]
    101120874 (GSTP1)
Enzymes [BR:oas01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101120874 (GSTP1)
Transporters [BR:oas02000]
 Other transporters
  Pores ion channels [TC:1]
   101120874 (GSTP1)
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2 Mei4 GST_N_3
Other DBs
NCBI-GeneID: 101120874
NCBI-ProteinID: XP_027815272
UniProt: A0A6P7D995
LinkDB
Position
21
AA seq 210 aa
MPPYTIVYFPTRGRCEALRMLLADQDQSWKEEVVTKESWLQGPLKASCLYGQLPKFQDGD
LTLYQSNAILRHLGRSFGLYGTDEREAALVDMVNDGLEDLRRRCGHLIHHKREEDKAQYV
RELPAHLKPFETLLSQNQGGQAFIVGDQISFADYNLLDLLLNHQVLVPGCLDPFPLLSAY
VARLSARPKLKAFLASPEHVNRPIFGSRKI
NT seq 633 nt   +upstreamnt  +downstreamnt
atgccgccctacaccatcgtctacttcccgacccgagggcgctgcgaggccctgcgcatg
ctgttggccgaccaggaccagagctggaaggaggaggtggtcaccaaggagagctggctg
cagggcccactcaaggcctcctgcctgtatgggcagctccccaagttccaggacggagac
ctcaccctttaccagtccaatgccatcctgcgacacctgggccgctcctttgggctctac
ggcacagatgagcgggaggcagcactggtggacatggtgaacgatggcctggaagacctc
cgcaggcgctgcggccacctcatccaccacaagcgtgaggaggacaaagcccaatatgtt
cgggagctgccggcgcacctgaagcctttcgagaccctgctgtcccagaatcaggggggc
caggccttcatcgtgggcgaccagatttccttcgctgactacaacctgctggacctgctg
ctcaatcatcaggtgctggtccctggctgcctggaccccttccccctgctctcagcctac
gtggcccgcctcagcgcccggcccaagctcaaggccttcctggcctccccagagcatgtg
aaccgtcccatctttggaagccgcaaaatatga

KEGG   Ovis aries (sheep): 105607169
Entry
105607169         CDS       T03117                                 

Definition
(RefSeq) glutathione S-transferase P
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
oas  Ovis aries (sheep)
Pathway
oas00480  Glutathione metabolism
oas00980  Metabolism of xenobiotics by cytochrome P450
oas00982  Drug metabolism - cytochrome P450
oas00983  Drug metabolism - other enzymes
oas01100  Metabolic pathways
oas01524  Platinum drug resistance
oas05200  Pathways in cancer
oas05204  Chemical carcinogenesis
oas05215  Prostate cancer
oas05225  Hepatocellular carcinoma
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    105607169
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    105607169
   00982 Drug metabolism - cytochrome P450
    105607169
   00983 Drug metabolism - other enzymes
    105607169
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105607169
   05204 Chemical carcinogenesis
    105607169
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105607169
   05215 Prostate cancer
    105607169
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    105607169
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    105607169
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:oas02000]
    105607169
Enzymes [BR:oas01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     105607169
Transporters [BR:oas02000]
 Other transporters
  Pores ion channels [TC:1]
   105607169
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2 GST_N_3
Other DBs
NCBI-GeneID: 105607169
NCBI-ProteinID: XP_027815273
UniProt: A0A6P7D978
LinkDB
Position
21
AA seq 210 aa
MPPYTIVYFPVQGRCEAMRMLLADQDQSWKEEVVAMQSWLQGPLKASCLYGQLPKFQDGD
LTLYQSNAILRHLGRTLGLYGKDQREAALVDMVNDGVEDLRCKYVSLIYTNYEAGKEDYV
KALPQHLKPFETLLSQNKGGQAFIVGDQISFADYNLLDLLRIHQVLAPSCLDSFPLLSAY
VARLNSRPKLKAFLASPEHVNRPINGNGKQ
NT seq 633 nt   +upstreamnt  +downstreamnt
atgccgccctacaccatcgtctacttcccggttcaagggcgctgcgaggccatgcgcatg
ctgctggccgaccaggaccagagctggaaggaggaggtggtagccatgcagagctggctg
cagggcccactcaaggcctcctgcctatacgggcagctccccaagttccaggacggagac
ctcacgctgtatcagtccaatgccatcctgcgacacctgggccgcaccctcgggctgtat
gggaaggaccagcgggaggcagccctggtggacatggtgaatgatggcgtagaggacctt
cgctgcaaatacgtctccctcatttacaccaactacgaggcgggcaaggaggactatgtg
aaggcactgccccagcacctgaagcctttcgagaccctgctgtctcagaacaagggtggc
caggccttcattgtgggcgaccagatctcctttgcggactacaacctgctggacctgctt
cggattcaccaggtcctggcccccagctgtctggactccttccccctgctctcggcctac
gtggcccgcctcaactcccggcccaagctcaaggccttcctggcctccccagagcacgtg
aaccggcccatcaacggcaacgggaaacagtga

KEGG   Ovis aries (sheep): 114116112
Entry
114116112         CDS       T03117                                 

Definition
(RefSeq) glutathione S-transferase P-like
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
oas  Ovis aries (sheep)
Pathway
oas00480  Glutathione metabolism
oas00980  Metabolism of xenobiotics by cytochrome P450
oas00982  Drug metabolism - cytochrome P450
oas00983  Drug metabolism - other enzymes
oas01100  Metabolic pathways
oas01524  Platinum drug resistance
oas05200  Pathways in cancer
oas05204  Chemical carcinogenesis
oas05215  Prostate cancer
oas05225  Hepatocellular carcinoma
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    114116112
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    114116112
   00982 Drug metabolism - cytochrome P450
    114116112
   00983 Drug metabolism - other enzymes
    114116112
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114116112
   05204 Chemical carcinogenesis
    114116112
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    114116112
   05215 Prostate cancer
    114116112
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    114116112
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    114116112
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:oas02000]
    114116112
Enzymes [BR:oas01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     114116112
Transporters [BR:oas02000]
 Other transporters
  Pores ion channels [TC:1]
   114116112
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2 GST_N_3
Other DBs
NCBI-GeneID: 114116112
NCBI-ProteinID: XP_027828341
UniProt: A0A6P7EDQ0
LinkDB
Position
8
AA seq 210 aa
MPPYTIVYFPVQGRCEAMRMLLADQDQSWKEEVVAMQSWLQGPLKASCLYGQLPKFQDGD
LMLYQSNAILRHLGRTLGLYGKDQREAALVDMVNDGVEDLRCKYVSLIYTNYEAGKEDYV
KALPQHLKPFETLLSQNKGGQAFTVGDQISFADYNLLDLLRIHQVLAPSCLDSFPLLSAY
VARLNSRPKLKAFLASPEHVNRPINGNGKQ
NT seq 633 nt   +upstreamnt  +downstreamnt
atgccaccctacaccatcgtctacttcccggttcaagggcgctgcgaggccatgcgcatg
ctgctggccgaccaggaccagagctggaaggaggaggtggtagccatgcagagctggctg
cagggcccactcaaggcctcctgcctatacgggcagctccccaagttccaggacggagac
ctcatgctgtatcagtccaatgccatcctgcgacacctgggccgcaccctcgggctgtat
gggaaggaccagcgggaggcagccctggtggacatggtgaatgacggcgtagaggacctt
cgctgcaaatacgtctccctcatttacaccaactacgaggcgggcaaggaggactatgtg
aaggcactgccccagcacctgaagcctttcgagaccctgctgtctcagaacaagggtggc
caggccttcactgtgggcgaccagatctcctttgcagactacaacctgctggacctgctt
cggattcaccaggtcctggcccccagctgtctggactccttccccctgctctcggcctac
gtggcccgcctcaactcccggcccaagctcaaggccttcctggcctccccagagcatgtg
aaccggcccatcaacggcaacgggaaacagtga

DBGET integrated database retrieval system