KEGG   Ovis aries (sheep): 101121261Help
Entry
101121261         CDS       T03117                                 

Gene name
DOT1L
Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase, H3 lysine-79 specific isoform X1
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
oas  Ovis aries (sheep)
Pathway
oas00310  Lysine degradation
oas05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101121261 (DOT1L)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    101121261 (DOT1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oas03036]
    101121261 (DOT1L)
Enzymes [BR:oas01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101121261 (DOT1L)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101121261 (DOT1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1 HALZ
Motif
Other DBs
NCBI-GeneID: 101121261
NCBI-ProteinID: XP_012034609
Ensembl: ENSOARG00000014177
LinkDB All DBs
Position
5
AA seq 1740 aa AA seqDB search
MGGETRWEGLGARGPASSGCHHHRGWRDGSKPCPIVFQDKHHDAAHEIIETIRWVCEEIP
DLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRH
ILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTEDDLFVDLGSGVGQV
VLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWR
ERIANTSVVFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGT
IMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQREN
KSNTTTPTKVPESKAAVPADTPVDSGAEEEKAGTAAVKKPSPSKARKKKLNKKGRKMVGR
KRGRPKKMSATNPERKPKKTQSALDLLHAQTVSRAASPLPQDAHRPPHSPFYQLPPSVQR
PTPEQLLLAPTPPALHRLLESFRIQYLQFLAYTKTPQYKATLQQLLDKEKEKNARLLGAA
QQLFGHCQAQKEESKRLFQQKLDELGVKALTYNDLIQAQKEISAHNQQLREQTEQLEKGN
RELRSQSLRLLKARCEELKLDWSTLSLENLLKEKQALKSQISEKQRHCLELQISIVELEK
SQRQQELLQLKSCVPPDEALALQLRGKPEAEPGRLHLELDCARFSLPPFSSLSPELSMNG
HAAGYELCSALGRPSPKQNTPQYLASPLDQEVVPCTPSHSGRPRLEKLSSLALPDYTRLS
PAKLVLRRHLSQDHAASGKAAASELHPRAEHAKENGLPYQSPGITNGIKLSPQDPRPSSP
TALQMGEKGPEKGVKERAYASSGEAITSLPVSIPLSTVQPSKLPVSIPLASVVLPSRAEK
ARSTPSPGPPARESSSTLEKQVAANTHGAGGNAAGSKSLALAPTGFAYSGSVAISGALAG
SPAPLGPGAEPPALDESSSSGSLFATVGSRSSTPQHPPLLTQPRTXLASSPPSPPSPPXX
XXXXXXPEVEAKRRIVFTISAGASSAKQSPSSKHSPLPSGARGDGGQGHGPDSRKRGRRK
RASAGALGPGAEPPALDESSTPTPADAATVAGLFTQSSGSPLNLNSMVSNINQPLEITAI
SSPESSLKSSPVPYQDNDQPPVLKKEKPLSQTNGAHYSPLTSDEEPGSEDEPGSARIERK
IATISLESKSPPKTLENGGSLAGRKAPLASEPVNSSKWKSTFSPISDLGLAKAADSPLQA
ASALSHNSLFAFRPGLEEPSTADGKLATHSRKSFPGTLPGAGGLSPNSLPASGFALGGGL
AADLSLHSFSDGASLSHKAPEAAGLGAPLSFPGPRGKEGGAAESGPFANKRQLDGLGPKG
EGALGPMSLQANLGPSVLQSLFSSVPAAGLVHVSTAATRLTGCRDRRHARALLPPASSPG
RSDAAGAGTERGAVVPEARVHAGWSRARGARGSRLAWHRGGVGWVQAGGGPARAPAACAS
LHLCPHAELQLPSLPPPRAALGSAGGARLLKLSFSLLFAGVFNHAVPPASAHPFGASFGS
GAACRSTTLSLTPLQAVASTPASSFQAPSSAEPRPPQPPPHLGRPPPGQPALHAPPHPNA
TLPPPPALLPANSEPVLLQNLASLPANQAFLPAASAASLPPANASLSIKLASLPHKVSRP
ALTVHHQPLPGLALAQVPGLALAQAAPVNPQASSTGPPAVWVSLGMPPPYAARLAGVKPR
NT seq 5223 nt NT seq  +upstreamnt  +downstreamnt
atgggtggggaaacaaggtgggaaggcctgggggctagagggcctgcctcctctggttgc
caccatcaccgaggctggagggacggctctaaaccctgtcccattgtctttcaggacaaa
caccacgatgctgctcatgaaatcatcgagaccatcagatgggtctgtgaggaaatcccg
gatctcaagctcgctatggagaattacgttttaattgactacgataccaaaagctttgag
agtatgcagaggctctgtgacaagtacaaccgggccatcgacagcatccaccagctgtgg
aagggcaccacacagcccatgaagctgaacacacggccgtccactgggctcctgcggcac
atcctgcagcaggtctacaaccactcggtgaccgaccctgagaagctcaacaactatgag
cccttctccccagaggtgtatggggagacctccttcgacctggtcgcccagatgatcgat
gagatcaagatgaccgaagatgacctgttcgtggacctgggcagtggggtgggccaggtc
gtgctgcaggttgccgcagccaccaactgcaaacatcattatggtgtagagaaagctgac
atcccagccaagtacgcggagacgatggaccgagagttcaggaagtggatgaaatggtat
ggaaaaaagcatgcagaatacacactggagaggggggacttcctctcggaggagtggaga
gaacggattgctaacacaagtgttgtatttgtgaataactttgcctttggtcctgaggtg
gatcaccagctgaaggagcggtttgcaaacatgaaggaaggtggcagaatcgtgtcctcg
aagccctttgcgcctctgaacttcagaataaacagtagaaacttgagtgacatcggcacc
atcatgcgcgtcgtggagctgtcgccgctaaaaggctcggtgtcatggacggggaagcca
gtctcctactacctgcacaccatcgaccgcaccatacttgaaaactatttttctagtcta
aaaaatccaaaactcagggaggaacaagaggcagctcggcgccggcagcagcgggagaac
aagagcaacacaaccacacccaccaaggtgcccgagagcaaggcagctgtgccggcagac
acccccgtggactctggtgctgaggaggagaaagccgggacggccgctgtcaagaagcca
tctccctccaaggcccggaagaagaagctgaacaagaagggccggaagatggtgggtcgg
aagcgtgggcgccccaagaagatgagtgccaccaaccccgagcgcaagcccaagaagacc
cagagcgcactggacctgctgcacgcccagaccgtgtcacgagcggcctcccccttgccg
caggacgcgcacaggccacctcacagcccattctaccagctacctcccagcgtgcagcgg
cctacccctgaacagctgctgctggcacccaccccgcccgcgctgcacaggctgctagag
tccttcaggattcagtatctacagttcctggcatacacgaagacccctcagtacaaggcc
accctgcagcagctgctggacaaggagaaggagaagaatgcccggttgctaggcgcagcg
cagcagctgtttggccactgccaagctcagaaggaggagagcaagaggctcttccagcag
aaactggacgagctgggagtgaaggcgctgacctacaacgacctgatccaagctcagaag
gagatctcggctcacaaccagcagttgagggaacagacggagcagctagagaagggcaac
cgggagctgaggagccagagcctgcggctgctcaaggcacggtgtgaggagctgaagctg
gactggtccacgctgtccctggagaatctgctgaaggagaagcaggccctgaagagccag
atctcagagaagcagaggcactgcctggaactgcagatcagcatcgtggagctggagaag
agccagcggcagcaggagctgctccagctcaagtcctgcgtgccgcctgatgaggcgctg
gccctgcagcttcgtgggaagccagaggccgagcctggccggcttcacttggagctggac
tgcgcccgcttctccctgccgcccttcagcagcttgagccccgagctctccatgaatggc
catgcggccggctatgagctctgcagcgcactgggtcggccctcacccaagcagaacacc
ccccagtacctggcctctccgctagaccaggaggtcgtgccctgcacccctagccacagc
ggccggccacggctggagaagctatccagcctggccctgcctgactataccaggctatcc
cctgccaagctggtgctgcggcgccacctgagccaggaccacgcggccagtggcaaggca
gctgccagcgagctgcacccacgagccgagcatgccaaggagaacggactcccttaccag
agccctggcatcaccaacggcatcaagctgagcccacaagacccccgaccttcatccccc
acggctttacagatgggagagaagggccctgagaagggtgtgaaggagcgtgcctacgcc
agcagtggggaggccatcaccagcctgcccgtcagcatcccgctgagcaccgtgcagccc
agcaagctgcccgtcagcatccccctggccagcgtggtgctgcccagccgcgccgagaag
gcgagaagcacacccagccctgggccaccggcccgagagtcctcgtctacgctggagaag
caggtggctgctaacacccatggtgccgggggcaacgctgctgggagcaagagcctcgcc
ctggctcccacaggctttgcatacagcggctcggtggccatcagtggggccctggcaggc
agcccagcaccccttggccctggagctgagcccccggccctggacgagtcctccagctct
ggaagcctctttgccactgtggggtcccgcagctccaccccgcagcacccacccctgctg
acgcagccacgcaccnncttggcttcgtctcccccttcccccccctctcctccccnnnnn
nnnnnnnnnnnnnnnnncccggaggtcgaagccaaaaggaggatcgtctttaccatctcg
gcgggtgccagcagcgccaagcagtcaccttccagcaaacacagccctctgccctcgggt
gcccgcggggatggtggccagggccatggaccagatagccgcaagcggggccggaggaag
cgggcatcggcgggggcccttggccctggagctgagcccccggccctggacgagtcctcc
acacccacccctgctgacgcagccactgtcgctgggcttttcacgcagtcttcagggtcc
cccctgaatctcaactccatggtcagcaacatcaaccagcccctggagatcacggccatc
tcgtcccctgagagctccctaaagagctcacccgtcccctaccaggacaatgaccaacca
cctgtgctcaagaaggagaagcccctgagccagaccaatggtgcccactactccccactg
acctcggacgaggagccaggctctgaggatgagcccggcagtgccagaattgagagaaaa
attgcaacaatctccttagaaagcaaatctccaccaaaaaccttggaaaatggtggcagc
ctagcaggaaggaaggcaccgctggccagcgagccggtcaacagcagcaagtggaagtcc
accttctcacccatctccgacctgggcctggccaaggcagctgacagcccgctgcaggct
gcctccgctctgagccacaactccctgttcgctttccggcctggcctggaggagcccagt
acagccgatggcaagctggccacccactccaggaagagcttcccaggcaccctgccgggg
gcgggcgggctgagccccaatagccttcctgccagcggcttcgccctgggcgggggccta
gcagctgacctcagtttacacagcttcagtgatggtgcttctctctcccacaaggccccc
gaggcagctggcctgggtgcccccctgagcttccctggcccacggggcaaggagggtggc
gctgcagagtctggccccttcgcaaacaagcggcagctggacggactgggcccaaaaggc
gagggggcgctgggccccatgtcgctacaggccaacctgggcccgtctgtgctgcagtcc
ctgttcagttctgtgcccgccgccggcctggttcacgtctcgaccgccgccaccagattg
accggctgtagggatcggcgccatgcccgggctctccttcctcccgcaagctcgcccgga
aggtccgatgcggccggcgctgggacagagcgaggggctgtggtgcccgaggcccgcgtg
catgcagggtggagcagagcacggggagccagaggctcccggctcgcgtggcaccgaggt
ggggtggggtgggtccaggccggcggtgggcccgcccgcgctcctgctgcctgcgcttcg
ctgcatctgtgcccgcacgcggagctgcagctgccgtcgcttcctcctccgcgtgctgct
cttggctcggctggaggtgcccgcctgttgaagctgagtttttctctcctgtttgcaggt
gtctttaaccacgcggtgcctcccgcctccgcccatccgtttggagccagtttcggcagt
ggggctgcatgtcgcagcaccacgctgagcttaaccccgctgcaggcggtggccagcacc
ccggcctcttcctttcaggccccgtcctctgcggagccgaggccaccccaaccccctccg
cacctgggccggccccctccggggcagcctgccctccacgcacccccccatcctaacgcc
accttgcctcctccccctgcgctgctcccagctaactctgagcccgtgcttctgcagaac
ctcgcatccctccctgctaaccaagctttcttgcccgccgcctctgccgcctctctgccg
cctgctaacgcctctctgtccatcaagctcgcctccctcccgcacaaggtgtcccggccc
gccttgacggtgcaccaccagcccctgcctgggctggccctggcccaggtgcctgggttg
gccctggcccaggccgcgcccgtgaacccacaggccagctccacggggccgcccgccgtg
tgggtttcccttggcatgccgcctccgtatgccgcgcgccttgcgggggttaagccgcga
taa

DBGET integrated database retrieval system