KEGG   Ovis aries (sheep): 101121289Help
Entry
101121289         CDS       T03117                                 

Gene name
KMT5C
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5C
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
oas  Ovis aries (sheep)
Pathway
oas00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101121289 (KMT5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oas03036]
    101121289 (KMT5C)
Enzymes [BR:oas01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101121289 (KMT5C)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101121289 (KMT5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 101121289
NCBI-ProteinID: XP_027834586
LinkDB All DBs
Position
14
AA seq 455 aa AA seqDB search
MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQHHLRSALEAFLRQRD
LEAAYRALTLGGWMAHYFQSRGPRQEAALKTHIYRYLRAFLPESGFTILPCTRYSMETNG
AKIVSTRAWKKNEKLELLVGCIAELREADEELLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPADGNAACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECYTCERRGEG
AFRLRPREPLPPRPLEKYELRETKRRLQQGLDGPRSCAHPPPLRRDPFCAACQPLHPPPC
STRLDASPLWLQWLPQPQLRVRPRRRRRLQPRRAPPPPVLRAARVSLHQWGGCGPHCCLR
AEARVALGQAPRACWAPQQDWHWARRYGLPSVVRVDLSRVAPALPATANPAPAGTPGPIA
VPKQALAFTPFSPPKRLRLVVSHGSIDLDVNSDGP
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggggcccgacagagtaaccgccagagaactgtgtgagaacgacgacctggccaccagc
ctcgtcctggacccctacctcggcttccgcacccacaagatgaacgtcagccccgtgccc
cccctgcgacgacagcaccacctgcgctcagctctggaggccttcctgaggcagcgggac
ctggaggctgcgtaccgggccctgacgctgggaggctggatggcccactacttccagagc
cggggcccacggcaggaggctgccctcaagacccacatctatcgctacctccgcgccttc
ctgcctgaaagtggcttcaccatcttgccctgtacccgttattccatggagacaaatgga
gccaagattgtgtcaactcgtgcatggaaaaagaacgagaagctggagctgctggtgggc
tgcatcgcggagctgcgggaggccgacgaggagctgctgagggctggggagaacgacttc
agcatcatgtactcgacccgcaagcgcagcgctcagctgtggctcggccctgccgccttc
atcaaccatgactgcaaacccaactgcaagtttgtgcctgcagatggaaacgcagcctgc
gtgaaggtgctccgggacatcgagccgggggacgaggtgacctgtttctatggcgagggc
ttcttcggcgagaagaacgagcactgtgaatgctacacctgcgagaggcgaggggagggc
gctttccgactgcggcccagggagcccctgccaccccggccgctggagaagtacgagctc
cgggagaccaagcggcggttgcagcaaggtctggacgggccccggtcctgtgcccaccca
cccccgctgcgccgggaccccttctgcgccgcctgccagcctctgcaccccccgccctgc
agcacccgactcgatgcctcacccctctggctccagtggctgcctcagccccagctccgg
gtgcgtccccggaggcgccgacgcctgcagccccggcgagccccgccgcctcctgttctc
cgagctgcccgagtctccctgcaccagtggggaggctgcggcccccactgctgcctgcgg
gcggaggcccgggtggccctgggtcaggccccccgtgcctgctgggccccccagcaggac
tggcactgggcccggcgctacgggctgccttctgtggtccgtgtggatctgagccgcgtg
gcgccagccctgcctgccactgccaaccctgcccctgccgggaccccaggccccatcgct
gtccccaagcaggcccttgccttcacccccttctccccacccaagcgcctgcggctggtg
gtcagccatggctccattgacttggatgtcaacagtgatgggccgtga

DBGET integrated database retrieval system