KEGG   Ovis aries (sheep): 101121679
Entry
101121679         CDS       T03117                                 

Gene name
MSH3
Definition
(RefSeq) DNA mismatch repair protein Msh3
  KO
K08736  DNA mismatch repair protein MSH3
Organism
oas  Ovis aries (sheep)
Pathway
oas01524  Platinum drug resistance
oas03430  Mismatch repair
oas05200  Pathways in cancer
oas05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    101121679 (MSH3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101121679 (MSH3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101121679 (MSH3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101121679 (MSH3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:oas03400]
    101121679 (MSH3)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     101121679 (MSH3)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_II MutS_IV
Other DBs
NCBI-GeneID: 101121679
NCBI-ProteinID: XP_012034303
Ensembl: ENSOARG00000014867
UniProt: W5PZR8
LinkDB
Position
5
AA seq 1118 aa
MSRRKPASGGAAPANPASAKQAVLSRFFQSTGSLKSTASPAVAAEKADPDSDSAAPLAST
LPPQLQPHVAEIDRSKKRALESDRPVKKKARKVQEKEGSDSVTSGNSEPKKHLRTRTVLK
SLEKLKEFCCDSALPQNRVQTEPLQKKFAVLPKCTDFEDIDLLRAKNAVSSEDSKSQTSQ
KDKTFSHFGPSQRSYENLQKTSDSKPSNKRTKSIYTPLELQYLEMKQQQKDAILCVECGY
KYRFFGEDAEIAARELNIYCHLDHNFMTASIPTHRLFVHVRRLVAKGYKVGVVKQTETAA
LKAIGDNKSSLFSRKLTALYTKSTLIGEDVNPLVKLDDAVNVDEVMTDTSTSYLLCICEN
KENVKDKKKGNVSIGIVGVQPATGEVVFDSFQDSASRSELETRILCLQPVELLLPSDLSE
QTETLIHRVTAMSVRDDRIRVERMKNVYFEYSHAFQEVTEFYAKDVVDIKDSQSFSDIIN
LEKPVICSLAAIIRYLKEFNLEKVLSKPKNFKQLSGEMEFMTINGTTLRNLEILQNQTDM
KTKGSLFWVLDHTKTSFGRRKLKKWVTQPLLKLREINARLDAVSEVLHSESSVFGQIENH
LRKLPDIERGLCSIYHKKCSTQEFFLIVKTLYHLKSEFQALIPVVNSHVESELLQTFILE
IPELLSPVEHYLKILNEQAAKTGDKTELFKDLSDFPLIKKRKDEIQDVTNKIQTHLQEIR
KILKNPSAQYVTVSGQEFMIEVKNSAVSCIPTDWVKVGSTKAVSRFHSPFIVENYRHLNQ
LREQLVLDCSAEWLAFLENFSEHYHTLCKAVHHLATIDCIFSLAKVAKQGVYCRPTLQEE
RKILIKNGRHPVIDVLLGEQDQFVPNSTDLSGDSERVMIITGPNMGGKSSYIKQVALITV
MAQVGSYVPAEEATIGIVDGIFTRMGAADNIYKGQSTFMEELTDTAEIIRKATPQSLVIL
DELGRGTSTHDGIAIAYATLEHFIRDVESLTLFVTHYPPVCELEKSYSQQVGNYHMGFLV
NEDESKQDAGEEDQVPDSVIFLYQITRGIAARSYGLNVAKLADVPGEILKKAASKSKELE
GLVNMKRKKLKSFAKLWTVNDAKDLQKWTEEEITDVSL
NT seq 3357 nt   +upstreamnt  +downstreamnt
atgtcgcgccggaagccggcctccggcggcgccgctcccgccaacccagcgtctgcaaag
caggctgttttgagcagattcttccagtctacgggaagcctgaaatccactgcatcccca
gcggttgcagccgagaaggcggaccctgactctgactccgcggcgcccctagcgtccacg
ctcccgccgcagttgcagccacacgttgcagaaattgacagaagtaaaaagagagcactg
gagagtgataggcctgttaaaaagaaagcgaggaaagtccaagaaaaggaaggaagtgat
tctgtaacgtctggaaactctgagcccaagaaacatctgaggaccaggactgttttaaag
tctctggaaaaactgaaagaattctgctgcgattctgcccttcctcaaaatagagtccag
acagaacctcttcagaagaagtttgcagttctgccaaaatgtactgattttgaggatatc
gatcttctacgtgcaaagaatgctgtttcttctgaagattccaaatcccaaactagccaa
aaggacaagacattcagccattttggaccatcacaaaggagttatgaaaacctacagaaa
acttctgattctaaaccatctaacaaacggactaaaagcatctacacacccttagaatta
caatacttagaaatgaagcagcagcagaaagatgcaattttgtgtgtggaatgtggatat
aagtatagattctttggggaagatgccgagattgcagcccgggagctcaatatctattgc
catttagatcacaactttatgacagcaagcatacctactcaccgactgtttgttcacgta
cgccgccttgtggccaaaggatataaggtgggagttgtgaagcaaactgaaacagctgcc
ttaaaggccattggggacaacaaaagttcactcttttcccggaaactgactgctctttat
acaaaatctacgcttattggagaagatgtgaatcctctggtcaagctggatgatgctgta
aatgtcgatgaggtaatgactgatacttctaccagctatcttctgtgtatctgtgaaaac
aaagaaaacgttaaagacaaaaaaaaggggaatgtttccattggaattgtgggagtacag
cccgccacaggtgaggttgtgttcgacagtttccaggactctgcttcccgttcagagctc
gaaactcggatactgtgcctgcagccggtggagctgctgcttccgtcagacttgtcggag
caaacagagacgctcatccacagggtcacggctatgagtgtgcgggatgacagaattcga
gtagaaaggatgaagaatgtgtattttgaatacagccatgctttccaagaggttacagaa
ttttatgcaaaagatgtagtcgacattaaagattctcaaagtttttctgacatcattaac
ttggagaagcctgtgatttgctctttggctgccataataagatacctcaaagagtttaac
ttagaaaaggtgctttccaaacccaagaattttaaacagttgtcaggtgaaatggaattt
atgacaattaatggaacaacattaaggaacctggaaatccttcagaatcagactgatatg
aaaaccaaaggaagtttattttgggttttagatcatactaaaacatcatttgggagacgc
aagttaaagaagtgggtgacccagccgctccttaaattaagggaaataaatgctcgactt
gatgctgtatctgaagttctccactcagaatccagtgtgtttggtcagatagaaaatcat
ctacgtaaattgcctgacatagagagaggactctgtagcatttatcacaaaaaatgttct
acgcaagagttcttcctgattgtcaaaaccctgtatcacttgaagtcagaattccaagca
ctaatacctgttgtgaattcccatgttgaatcagagttgctccagacatttattttagaa
attcctgaactcctcagtccagtggagcattacttaaagatactcaatgaacaagctgcc
aagactggggataaaactgaattattcaaagacctttctgacttccctttaataaaaaag
aggaaagatgaaattcaagacgttaccaacaagatccaaacacatttgcaagaaatacga
aaaatactaaaaaatccttctgcacaatatgtgactgtatcaggacaggagtttatgatt
gaagtaaagaattctgctgtatcttgtataccaactgattgggttaaggttggaagcaca
aaagctgtgagtcgctttcactctccttttattgtagaaaattacagacatctgaatcag
ctccgggagcagctagtccttgactgcagtgctgaatggcttgcttttctagagaatttc
agtgaacattatcacaccttgtgtaaagcagtccatcacctagcaacgattgactgcatt
ttctccctggccaaggtcgctaagcaaggggtttattgcagaccaactctacaagaagaa
aggaaaatcctaataaaaaatggccggcaccctgtgattgatgtgctgctgggagagcag
gaccagtttgttcccaatagtacagatttgtcaggggactcggagagagtaatgataatt
actggaccaaacatgggtggaaaaagctcgtatataaaacaggttgcactgattactgtc
atggctcaggttggctcctatgtacctgcagaggaagcaacaattggaattgtggatggc
attttcacaaggatgggggctgcagataacatatataaaggacagagtacatttatggaa
gaactgactgacacagcagaaataataagaaaagcaacaccacagtcgttggttatcttg
gatgaattgggaagggggacgagcacccatgacggaattgccattgcttatgctacactt
gaacatttcattagagatgtggaatccttaaccctgtttgttacccattatccaccagtt
tgtgaactggaaaaaagttactcacagcaggtggggaattatcacatgggatttttggtc
aacgaggatgaaagcaaacaggatgcaggtgaagaagaccaggtccctgattctgtcata
tttctttatcaaataaccagaggaattgcagcaaggagttacggactcaatgtggctaaa
ctagcagatgttcctggagaaattttaaagaaagcagctagcaagtccaaagagctggaa
ggattagtaaatatgaaaaggaaaaagctaaagagttttgcgaagctatggacggtaaat
gatgcaaaagacttgcaaaagtggacagaagaagaaattacagacgtctctttgtga

DBGET integrated database retrieval system