KEGG   Ovis aries (sheep): 101121692Help
Entry
101121692         CDS       T03117                                 

Gene name
GAA
Definition
(RefSeq) lysosomal alpha-glucosidase isoform X1
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
oas  Ovis aries (sheep)
Pathway
oas00052  Galactose metabolism
oas00500  Starch and sucrose metabolism
oas01100  Metabolic pathways
oas04142  Lysosome
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101121692 (GAA)
   00500 Starch and sucrose metabolism
    101121692 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101121692 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oas04147]
    101121692 (GAA)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101121692 (GAA)
Exosome [BR:oas04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101121692 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 101121692
NCBI-ProteinID: XP_012041866
Ensembl: ENSOARG00000002285
LinkDB All DBs
Position
11
AA seq 929 aa AA seqDB search
MMRWPPCSRTLLGVCTLLSLALLGHILLHDLEMVPRELRGFSQDEIHQACQPGASSPDCR
GSPRAAPTQCDLPPNSRFDCAPDKGITQQQCEARGCCYVPAEWPPDAPLGYPSYRLENLT
STETGYTATLTRAVPTFFPKDIMTLKLDVLMETESRLHFTIKDPANRRYEVPLETPRVSS
QAPFTLYSVEFSEEPFGVVVRRKLDGRVLLNTTVAPLFFADQFLQLSTSLPSHYITGLAE
HLGSLMLSTNWTKITLWNRDIAPEPNVNLYGSHPFYLVLEDGGLAHGVFLLNSNAMDVVL
QPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGRPHPSPGCSLPNPSCPLTVYSTS
AITRQVVENMTRAYFPLDVQWNDLDYMDARRDFTFNKDHFGDFPAMVQELHQGGRRYIMI
VDPAISSSGPAGTYRPYDEGLRRGVFITNETGQPLIGQVWPGLTAFPDFTNPEALDWWQD
MVTEFHAQVPFDGMWIDMNEPSNFVRGSVDGCPDNSLENPPYLPGVVGGTLRAATICASS
HQFLSTHYDLHNLYGLTEALASHRALVKARGTRPFVISRSTFAGHGRYSGHWTGDVWSNW
EQLSYSVPETLLFNLLGVPLVGADICGFLGNTSEELCVRWTQLGAFYPFMRNHNALISQP
QEPYRFSETAQQAMRKAFTLRYVLLPYLYTLFHGAHVRGETVARPLFLEFPEDPSTWTVD
RQLLWGEALLITPVLEAEKVEVTGYFPQGTWYDLQTVPMEAIGSLPPPAPLTSVIHSKGQ
WVTLSAPLDTINVHLRAGYIIPMQGPALTTTESRKQPMALAVALTASGEAQGELFWDDGE
SLGVLDGGDYTQLIFLAKNNTFVNKLVHMSSEGASLQLRNVTVLGVATAPQQVLCNSVPV
SNFTFNPDTETLAIPVSLTMGEQFVISWS
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atgatgaggtggccaccctgctcccgcaccctgctgggggtctgcaccctcctctccttg
gccctcctggggcacatcctgcttcatgacttggagatggtcccccgagaactacgaggc
ttctcccaagatgagattcaccaagcttgccagccaggagccagcagcccagattgccgt
ggcagccccagggcagcgcccacacagtgcgatctgccccccaacagccgcttcgactgc
gccccagacaagggcatcacccagcagcaatgtgaggcccgcggctgctgctacgtgcct
gcagagtggcctccggatgccccgctgggctaccccagttacaggctggagaatctgacc
tccactgagacagggtacacggccaccctgacccgtgccgtcccgaccttcttccccaag
gacatcatgaccttgaagctggacgtgttgatggagaccgagagcagacttcacttcacg
atcaaagatcccgccaacagacgctatgaggtgcccttggagaccccgcgtgtcagcagc
caggcaccgttcacactctacagcgtggagttctcagaggagccctttggggtggtcgtg
cggcggaagctggacggacgggtgctgctgaacactacggtggcccccctgttctttgcg
gaccaatttctgcagctgtccacctccctgccatcccactatatcacaggccttgccgaa
caccttgggtccctgatgctcagcaccaattggaccaagatcaccctctggaaccgggac
atcgcccctgagcccaacgtgaacctgtacggatctcaccctttctacctggtcctggag
gatggcgggttggctcacggggtcttcctgctgaacagcaatgccatggatgtggtcctg
cagcccagcccagccctcagctggaggtcgacaggcgggatcctggacgtgtacatcttc
ctgggcccggagcccaagagcgtggtgcagcagtacctggatgtcgtgggtaggcctcac
cccagccccggctgctccctccccaacccctcctgcccactcacagtctactccacctct
gccatcacccgccaggtcgtggagaacatgaccagggcctacttccccctggatgttcag
tggaatgacctcgactacatggatgccagacgggacttcactttcaacaaggaccacttt
ggggacttcccagccatggtgcaggagctccaccagggtggtcggcggtacatcatgatc
gtggatcctgccatcagcagctcaggccctgctgggacctaccgaccctacgacgagggt
ctgaggcggggggtcttcatcaccaatgagactgggcagccactgattgggcaggtgtgg
cccggactcaccgccttccccgacttcaccaaccccgaagctcttgactggtggcaggac
atggtgaccgagttccacgcccaagtgcccttcgatggcatgtggatcgatatgaacgag
ccatccaattttgtgaggggctcagtggatggctgcccagacaacagcctggagaacccg
ccctacctcccaggggtggttggcgggaccctccgggcagccaccatctgcgcctccagc
caccagttcctgtccacacactatgacctgcacaacctgtatggcctgactgaagcctta
gcctcccacagggccctggtgaaggctcgagggacacgtccctttgtgatctctcgctca
acctttgccggccatggccgatactctggtcactggactggggatgtgtggagcaactgg
gagcagctttcctactctgtgccagaaaccttgcttttcaatctgctgggggtgcccctg
gtgggggccgacatctgtggcttcctgggcaacacctcagaggagctgtgtgtgcgttgg
acccagctgggggccttctaccccttcatgcggaaccacaatgccctgatcagccagccg
caggaaccatacaggttcagcgagacggcgcagcaagccatgaggaaggccttcaccctg
cgctacgtgctgctgccctatctctacacgctgttccacggggcccacgtcagaggcgag
acggtggcccggcccctcttcctggagttccccgaggaccccagcacctggactgtggac
cgccagctcctgtggggggaggctctgctcatcaccccagtgctcgaggctgagaaggtt
gaagtcactggctacttcccccagggcacatggtacgacctgcagacggtaccaatggaa
gccattggcagcctcccgcctcctgcacccctcacgtctgtcatccacagcaaggggcag
tgggtgacgctatccgccccactggacaccatcaatgtccacctccgggccgggtacatc
atccctatgcagggccctgccctcacgaccactgagtcccgcaagcagcccatggccctg
gctgtggccctgacagccagtggggaggcccaaggggagctgttctgggatgacggggag
agcctgggagtgctggatggtggggactacacgcagctcatcttcctggccaagaacaac
acctttgtaaacaagctggtgcacatgagcagtgagggggccagcctgcagctgaggaac
gtgaccgtcctgggggtggccacagccccgcagcaggtcctctgcaacagcgttcctgtc
tccaacttcaccttcaaccctgacacggagactctggccatccctgtctcgctgaccatg
ggagagcagtttgtcatcagctggtcttaa

DBGET integrated database retrieval system