KEGG   Ovis aries (sheep): 101121740Help
Entry
101121740         CDS       T03117                                 

Gene name
TUFM
Definition
(RefSeq) elongation factor Tu, mitochondrial isoform X1
  KO
K02358  elongation factor Tu
Organism
oas  Ovis aries (sheep)
Brite
Translation factors [BR:oas03012]
 Eukaryotic Type
  Elongation factors
   101121740 (TUFM)
 Prokaryotic Type
   101121740 (TUFM)
Mitochondrial biogenesis [BR:oas03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    101121740 (TUFM)
Exosome [BR:oas04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101121740 (TUFM)
  Exosomal proteins of breast cancer cells
   101121740 (TUFM)
  Exosomal proteins of colorectal cancer cells
   101121740 (TUFM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 101121740
NCBI-ProteinID: XP_011960184
Ensembl: ENSOARG00000002357
LinkDB All DBs
Position
24
AA seq 532 aa AA seqDB search
MGMPGRSGWAYLQLRHKAARSVVRPARRVGLDSKWFGAKTFRSHPRRGRCLCFKKAWTVP
PDLASPSHDTDFHPQLPFPRCTRRPPCPVLSAFSAVSAPAQHHYCRGFCGSTTTPETAVC
GAAAYTQPGTYVRDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPE
ERARGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQ
TREHLLLARQIGVEHVVVYVNKADAVQDSEMVELVELEIRELLTEFGYKGEETPIIVGSA
LCALEQRDPELGLKSVQKLLDAVDTYIPVPTRDLEKPFLLPVESVYSIPGRGTVVTGTLE
RGILKKGDECEFLGHSKNIRTVVTGIEMFHKSLDRAEAGDNLGALVRGLKREDLRRGLVM
AKPGSIQPHQKVEAQVYILSKEEGGRHKPFVSHFMPVMFSLTWDMACRIILPPGKELAMP
GEDLKLTLILRQPMILEKGQRFTLRDGNRTIGTGLVTDTPAMTEEDKNIKWS
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgcctggccgcagcggctgggcctacctccagctgcgacacaaggccgccaga
tctgtcgtcagacccgcgcggcgggtcggactggactccaagtggttcggggccaagacg
ttccggagtcatccacgccggggccgctgcctctgcttcaagaaggcctggaccgtccct
ccggacctggcctcgccctcccacgataccgacttccatccgcaattgccctttccccgc
tgcacgcgccggcccccgtgcccggtactctccgccttttcagcggtctcggcgccggcc
cagcaccactattgcaggggcttttgcggcagcacaacaacccccgagaccgcggtttgc
ggggccgccgcgtatacgcagccggggacctatgtacgtgacaagccccatgtgaacgtg
ggtaccatcggccatgtagaccatgggaagaccaccctcaccgcggccatcacgaaaatt
ttagcggagggaggtggggccaagtttaagaagtacgaagagattgacaacgccccagag
gagcgagcccgaggtatcacaatcaatgcggctcatgtggagtatagcacagccgcccgc
cactatgcccacactgactgccccggtcatgcagattacgttaagaatatgatcacaggc
actgcccccctcgatggctgcatcctggtggtggcagccaatgatggccccatgccccag
acccgagaacacttactgctagccagacagattggtgtcgagcatgtggtggtgtatgtg
aataaggcggacgctgtgcaggactctgagatggtggagctggtggagctggagatcagg
gaactgctgactgagtttggctacaaaggggaggagactccaatcattgttggttctgcc
ctctgtgcccttgagcaacgtgaccctgagctaggcctgaagtccgtgcagaagctactg
gatgctgtggacacatacatcccagtgcccacccgggacctggagaagcctttcctgctg
cccgtggagtcagtgtactcgatccctggccggggcacagtggtgacaggcacgctcgaa
cgtggcattttgaagaaaggagacgagtgtgaattcctgggacacagcaagaatattcgc
actgtggtgacaggcattgagatgttccacaagagcctggatagggcagaggcgggcgac
aaccttggggccctggtccgaggcttgaagcgggaggacctgagacgtggcctggtcatg
gccaagccaggttccatccagccccaccagaaggtggaggcacaggtgtacatcctcagc
aaggaagagggtggccgccacaagccttttgtatcccacttcatgcctgtcatgttctcc
ctgacttgggacatggcctgtcggatcatcttacctccagggaaggagcttgccatgcct
ggggaggacctgaagctcacgctcatcttgcggcagccaatgatcttggagaaaggccag
cgtttcaccctgcgggacggcaaccggaccatcggcactggcctcgtcactgacacgccg
gccatgaccgaggaggacaagaacatcaagtggagttga

DBGET integrated database retrieval system