KEGG   Ovis aries (sheep): 101121911Help
Entry
101121911         CDS       T03117                                 

Gene name
OXSM
Definition
(RefSeq) 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
oas  Ovis aries (sheep)
Pathway
oas00061  Fatty acid biosynthesis
oas00780  Biotin metabolism
oas01100  Metabolic pathways
oas01212  Fatty acid metabolism
Module
oas_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    101121911 (OXSM)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    101121911 (OXSM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:oas01004]
    101121911 (OXSM)
Enzymes [BR:oas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     101121911 (OXSM)
Lipid biosynthesis proteins [BR:oas01004]
 Fatty acid synthase
  Component type
   101121911 (OXSM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Motif
Other DBs
NCBI-GeneID: 101121911
NCBI-ProteinID: XP_004021865
Ensembl: ENSOARG00000004117
UniProt: W5P1U9
LinkDB All DBs
Position
26
AA seq 460 aa AA seqDB search
MLSDGLQIFLRITKRHLIHARSCQRLVNERRCLATASARGLRRRVVVTGIGLVTPLGVGT
QLVWDRLVRGESGIVSLVGDEYQSIPCSVAAYVPRGCDEGQFNELNFVSKSDTKSVSPPT
VMAIAAAELALKDAGWHPQSEADQAATGVAIGMGMVPLEVISETALTFQTKGYSKVSPFF
VPKILVNMPAGQVSIRHKLKGPNHAVSTACTTGAHAVGDAFRFVAHGDADVMVAGGTDSC
ISPLSLAGFARARALSTNADPKSACRPFHPQRDGFVMGEGAAVLVLEEHGHALRRGARVY
AEIVGYGLSGDAGHITAPDPGGEGAFRCMAAAVKDAGIQPEEVSYINAHATSTPLGDAAE
NKAIKQLFKDHAHALAISSTKGATGHLLGAAGAAEAAFTALACYHRKLPPTLNLDCTEPQ
FDLNYVPLKAQDWKAENRRIALTNSFGFGGTNATLCIAGM
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccgatggcttgcaaattttcctaaggattaccaaacgtcatctgatacacgca
agatcgtgccagcgattagtaaatgaaaggcggtgtttggcaaccgcatcagcacgagga
ttgcgtcggcgggtcgtggtcactggcatcggtttagtgacccctcttggcgttggaact
cagctggtgtgggaccgccttgtccggggagagagtggaatcgtctccctggttggagac
gagtaccagagcatcccgtgcagcgttgctgcttacgtgccaagaggttgtgatgaaggg
cagttcaacgagctaaactttgtgtccaagtcagatactaagtccgtgtctcctcccacg
gtgatggccatcgctgccgctgagttagccttaaaagatgcgggctggcaccctcaatca
gaagctgaccaggcagctacaggcgtcgcaatcggcatgggaatggttcctctcgaagtg
atttccgaaaccgctttaacgtttcagaccaaaggttacagtaaagtcagcccattcttc
gtccctaagattctggtcaacatgccagcaggccaagtcagcatccgccataaactcaag
ggccccaaccacgcggtctccacggcctgcaccaccggggctcacgcggtgggagacgcg
ttcaggttcgtagcccacggagatgcggacgtgatggtggccggggggacggactcttgc
atcagccccttgtcccttgctgggttcgccagagcccgggctctgagcacaaacgcggat
ccaaagtccgcctgtcgaccgtttcacccccagagggacgggtttgtcatgggagaaggc
gcggccgtgctggtcctggaagaacacgggcatgcgctccgcagaggggcccgggtctac
gcagagattgtgggttacggactctccggggatgctggccacataaccgcccccgaccct
ggaggagagggtgccttcaggtgcatggccgctgctgtgaaagatgcaggcatccaacct
gaagaggtatcctacatcaatgcacatgctacttccacgcctttgggagatgctgctgaa
aacaaagccatcaaacagcttttcaaagaccacgcacacgcccttgccatctcctccacc
aagggagccacggggcacctcctgggggctgccggggcggccgaggccgcctttaccgcc
ctggcttgttaccatcggaaactgccgcctactctaaacctggactgcacagagccgcag
tttgatctcaattacgtgccactcaaggcacaggactggaaagctgagaacagacgaatt
gcactcaccaattccttcggtttcggcggtactaatgcaacactttgtattgctggcatg
tag

DBGET integrated database retrieval system