KEGG   Ovis aries (sheep): 101122669
Entry
101122669         CDS       T03117                                 

Gene name
CUL3
Definition
(RefSeq) cullin-3 isoform X1
  KO
K03869  cullin 3
Organism
oas  Ovis aries (sheep)
Pathway
oas04120  Ubiquitin mediated proteolysis
oas04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101122669 (CUL3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101122669 (CUL3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:oas04121]
    101122669 (CUL3)
   03400 DNA repair and recombination proteins [BR:oas03400]
    101122669 (CUL3)
Ubiquitin system [BR:oas04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Cullin
     101122669 (CUL3)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     101122669 (CUL3)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 RhgB_N Phage_antitermQ
Other DBs
NCBI-GeneID: 101122669
NCBI-ProteinID: XP_014949041
Ensembl: ENSOARG00000020419
LinkDB
Position
2
AA seq 768 aa
MSNLSKGTGSRKDTKMRIRAFPMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRN
AYTMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIR
DILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDR
GAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEAR
INEEIERVMHCLDKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLACMY
KLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLQESF
NNDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVETILDKAMVLFR
FMQEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSIS
NTTMDEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYL
AKHSGRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMT
ILMLFNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFT
VNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHN
VLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgtcgaatctgagcaaaggcacgggcagccggaaggacaccaagatgcggatccgggcc
tttccgatgaccatggatgaaaaatatgtaaacagcatttgggaccttctgaaaaatgca
attcaagaaatccagcgtaagaataacagtggtcttagttttgaggagctctatagaaat
gcatatacaatggttttgcataaacatggagaaaagctctacactggactaagagaagtt
gttaccgaacatctcataaataaggtgcgagaagatgtactaaattcattgaataacaac
tttcttcaaacgctaaatcaagcttggaatgatcatcagacagctatggtgatgattaga
gacatactaatgtatatggaccgtgtatatgtacaacaaaataatgtggagaatgtctac
aatttgggattaattatttttcgagatcaagttgtacgctatgggtgtattagggatcat
ctccggcaaacgctattggatatgattgccagggagcggaaaggagaagtcgtagaccga
ggcgctataagaaatgcttgccagatgttaatgatattaggtctcgaaggacgatcagtc
tatgaagaagattttgaggctccttttttggaaatgtctgcagagttttttcagatggaa
agccagaaatttctagcagaaaacagtgcttcagtatatataaagaaagtagaagctaga
attaatgaagaaatagaacgagtgatgcactgccttgacaaatcaaccgaagagccgatt
gtaaaggtggttgagagggaactcatttccaagcacatgaaaactatagtagaaatggag
aattcggggctagtacatatgttgaaaaatggcaagacagaagaccttgcttgcatgtac
aagttgtttagtcgtgtgccaaatggtttgaaaacgatgtgtgagtgtatgagttcctat
ttgagggaacaaggtaaagcccttgtttctgaggaaggagaaggaaagaatcccgtagac
tatatccagggcttgttggatctgaagagtaggtttgatcgcttcctccaggaatcgttc
aataacgacaggctctttaaacagactattgcgggtgactttgagtattttctcaacctc
aactccaggtcccctgaatacctctcattatttattgatgataagctgaaaaagggagtc
aaagggctaacagaacaagaagtagaaacaatattggataaggcaatggtcctttttagg
tttatgcaagaaaaagatgtatttgaacgttattataagcaacacttggcaaggagactt
cttacaaataaaagtgtttctgatgactctgaaaaaaatatgatttctaagttaaagact
gaatgtggatgtcaattcacatcaaaactggaaggaatgtttagggatatgagcatctca
aacacaactatggatgagttcaggcaacatctacaggccactggggtatctttaggtggt
gttgatctcacagtccgggtgctcacaacaggatactggcccactcagtcagccacacca
aagtgcaacatcccaccagcaccaagacacgcttttgagatattcagaaggttttactta
gccaaacacagtggtcgacagctcacactccagcatcacatgggttctgcagatctcaat
gccaccttctatggaccagttaaaaaggaagatggatctgaagttggtgttggaggtgca
caagtaactggctctaatacacggaagcatatattgcaagtctccactttccagatgacc
atattaatgctcttcaataatagagaaaaatacacatttgaggaaattcaacaggagaca
gatatccctgaaagagaacttgttagagccctgcaatccctcgcctgtggtaaaccaaca
cagcgggtcctcaccaaggagcccaagtcaaaggagatagaaaatggtcacatatttaca
gttaatgatcagttcacgtccaaactacacagagtcaagattcaaacagttgctgccaag
caaggtgaatccgacccagaaaggaaagaaacaaggcagaaagtagacgacgacagaaaa
catgagatagaagctgctatagtgcggataatgaaatctaggaagaagatgcagcacaat
gtgttagtagcagaggtaactcagcagttgaaggctcgattcttaccaagtccagttgtt
attaaaaaacgtattgaaggacttattgagagagaatatttggcacgaacacctgaggat
cgcaaagtatacacatatgtagcataa

DBGET integrated database retrieval system