KEGG   Ovis aries (sheep): 101122781
Entry
101122781         CDS       T03117                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4 precursor
  KO
K05430  interleukin 4
Organism
oas  Ovis aries (sheep)
Pathway
oas04060  Cytokine-cytokine receptor interaction
oas04151  PI3K-Akt signaling pathway
oas04630  JAK-STAT signaling pathway
oas04640  Hematopoietic cell lineage
oas04657  IL-17 signaling pathway
oas04658  Th1 and Th2 cell differentiation
oas04659  Th17 cell differentiation
oas04660  T cell receptor signaling pathway
oas04664  Fc epsilon RI signaling pathway
oas04672  Intestinal immune network for IgA production
oas05140  Leishmaniasis
oas05200  Pathways in cancer
oas05310  Asthma
oas05320  Autoimmune thyroid disease
oas05321  Inflammatory bowel disease
oas05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101122781 (IL4)
   04151 PI3K-Akt signaling pathway
    101122781 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101122781 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101122781 (IL4)
   04660 T cell receptor signaling pathway
    101122781 (IL4)
   04658 Th1 and Th2 cell differentiation
    101122781 (IL4)
   04659 Th17 cell differentiation
    101122781 (IL4)
   04657 IL-17 signaling pathway
    101122781 (IL4)
   04664 Fc epsilon RI signaling pathway
    101122781 (IL4)
   04672 Intestinal immune network for IgA production
    101122781 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101122781 (IL4)
  09163 Immune disease
   05310 Asthma
    101122781 (IL4)
   05320 Autoimmune thyroid disease
    101122781 (IL4)
   05321 Inflammatory bowel disease
    101122781 (IL4)
   05330 Allograft rejection
    101122781 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101122781 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oas04052]
    101122781 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:oas00536]
    101122781 (IL4)
Cytokines and growth factors [BR:oas04052]
 Cytokines
  Interleukins
   101122781 (IL4)
Glycosaminoglycan binding proteins [BR:oas00536]
 Heparan sulfate / Haparin
  Cytokines
   101122781 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 101122781
NCBI-ProteinID: NP_001009313
Ensembl: ENSOARG00000014896
UniProt: P30368
LinkDB
Position
5
AA seq 135 aa
MGLTSQLIPALVCLLVCTSHFVHGHKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAP
KNATEKETFCRAGIELRRIYRSHMCLNKFLGGLDRNLSSLASKTCSVNEAKTSTSTLRDL
LERLKTIMKEKYSKC
NT seq 408 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccagctgatcccagcgctggtctgcttactggtatgtaccagccac
ttcgtccatggacacaagtgtgatattaccttagaagagatcatcaaaacgctgaacatc
ctcacatcgagaaagaattcatgcatggagctgcctgtagcagacgtctttgctgcccca
aagaacgcaactgagaaggaaaccttctgcagggctggaattgagcttaggcgtatctac
aggagccacatgtgcttgaacaaattcctgggcggacttgacaggaatctcagcagcctg
gcaagcaagacctgttctgtgaatgaagccaagacgagtacaagtacgctgagagacctc
ttggaaaggctaaagactattatgaaggagaaatactcaaagtgttga

DBGET integrated database retrieval system