KEGG   Ovis aries (sheep): 101123140Help
Entry
101123140         CDS       T03117                                 

Gene name
TGM2
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2 isoform X1
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
oas  Ovis aries (sheep)
Pathway
oas05016  Huntington's disease
Brite
KEGG Orthology (KO) [BR:oas00001]
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    101123140 (TGM2)
Enzymes [BR:oas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101123140 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core A2M_N
Motif
Other DBs
NCBI-GeneID: 101123140
NCBI-ProteinID: XP_012044569
Ensembl: ENSOARG00000018528
LinkDB All DBs
Position
13
AA seq 687 aa AA seqDB search
MAEDLVLERCDLELEVNGCDHHTADLCRERLVVRRGQPFWLTLHFEGRNYEASVDSLTFC
AMTGPDPSEETGTKALFRLSDAMEEGAWAAVVVDQQDSTLSLQFSTPANAPIGHYRLSLE
ASTGYQGSSFMLAQFTLLFNSWCPADAVYLNSDEERQEYVLTQQGFIYQGSAKFIKSIPW
NFGQFEDGILDICLMLLDVNPKFLKNAGRDCPRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGISPMFWIGSVDILRRWKEDGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEYGEIQSDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIRQDDGSLHKSINHSL
VVGLKISTKSVGRDDREDITHNYKYPEGSPEEREAFTRANHLNKLVDKEETGVAMRIRVG
EGMNRGCDFDVFAHITNSTPEEHTGRLLLCARTVSYNGILGPECGTKDLLSLSLEPYSEK
SIPLRILYEKYCDCLTESNLIKVRGLLIEPAANSYLLAERDIYLENPEIKIRILGEPKQN
RKLVAEVSLRNPLTEALSGCTFTVEGSGLIEGQKTVDAPDPVEAGEEVKVRVDLLPLYVG
RHKLVVNFESDRLKAVKGFRNVIVGPA
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggatctggtcctggagagatgtgacctggagctggaggtcaatggctgtgac
caccacacagctgacctgtgcagggagaggctggtggtgcggcggggccagcccttctgg
ctgactctgcacttcgagggccgaaactatgaggccagcgtggacagcctcaccttctgt
gccatgactggcccagaccccagtgaggagaccgggaccaaggccctcttcaggctgtcc
gatgctatggaggagggggcctgggcagcggtggtagtggaccagcaagacagcaccctc
tcgctgcagttcagcaccccggccaatgcccctattggccattaccgcctcagcttggag
gcctccaccggctaccagggctccagtttcatgctggctcagttcaccctgctcttcaac
agctggtgtccagcggatgctgtgtacctgaactcagatgaggagcggcaagaatatgtc
cttacccagcaaggcttcatctaccagggctcagccaagttcatcaagagcataccttgg
aattttgggcagtttgaagacgggatcctagacatctgcctgatgctcctggacgtcaac
cccaagttcctgaagaatgccggccgagactgcccccgccgcagtagtccggtctatgtg
ggccgggtggtaagcggcatggtcaactgcaacgatgaccagggcgtgctgctggggcgc
tgggacaacaactacggggacggcatcagccccatgttctggatcggcagcgtggacatc
ctgcggcgctggaaggaagatggctgccagcgtgtcaagtatggccagtgctgggtgttt
gcagctgtggcctgcaccgtgctgcggtgccttggcatccccacccgcgtcgtgaccaac
tataactcagcccacgaccagaacagcaacctgctcattgagtacttccgcaacgagtac
ggggagatccagagtgacaagagcgagatgatctggaacttccactgctgggtggagtcg
tggatgaccaggccagaccttcagccggggtacgaggggtggcaggccctcgaccccaca
ccccaggagaagagcgaagggacttactgctgtggcccggttcccgttcgtgccatcaag
gagggcgacctaagcaccaaatacgacgcccctttcgtctttgccgaagtcaacgctgac
gtggtggactggatccggcaggacgatgggtctctgcacaaatccatcaaccactccctg
gtggtggggctgaagatcagcacgaagagtgtgggcagagatgatcgggaggacatcacc
cacaactacaagtacccagaggggtccccagaagagagggaagccttcacgagagccaac
cacctgaacaaactggttgataaagaggagacaggggtggccatgcggatccgtgtgggc
gagggcatgaacaggggctgcgacttcgacgtctttgcccacatcaccaacagcaccccc
gaggagcacactggccgcctcctgctctgtgcccgcaccgtcagctacaacgggatcctg
ggacctgagtgcggcaccaaggatctgctcagcctttccctggagccctactccgagaag
agcattccccttcgaatcctctacgaaaagtactgtgattgcctgaccgaatcgaacctt
atcaaggtgcggggccttctcattgagccggctgccaatagctacctgctggccgagagg
gacatctacctggagaatccagaaatcaagatccggatcctgggagagcccaagcagaac
cgcaagctggtggctgaggtgtctctgcggaacccgctcaccgaggcgctgtcaggctgc
accttcactgtggaggggtcaggcctgatcgaggggcagaagacggtggatgccccggac
cccgtggaggcaggggaggaagtcaaagtgagggtggacctgctgcccctgtacgtgggc
cgccacaagctggtggtgaacttcgagagcgacaggctgaaggccgtgaagggcttcagg
aacgtcatcgttggccccgcctaa

DBGET integrated database retrieval system