KEGG   Ovis aries (sheep): 106990414Help
Entry
106990414         CDS       T03117                                 

Definition
(RefSeq) histone H3.1
  KO
K11253  histone H3
Organism
oas  Ovis aries (sheep)
Pathway
oas05034  Alcoholism
oas05202  Transcriptional misregulation in cancer
oas05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:oas00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    106990414
  Immune diseases
   05322 Systemic lupus erythematosus
    106990414
  Substance dependence
   05034 Alcoholism
    106990414
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    106990414
Exosome [BR:oas04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106990414
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 106990414
NCBI-ProteinID: XP_014958044
LinkDB All DBs
Position
20
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtacaaagcagacggctcgcaagtccaccggtggcaaggcgccgcgcaaacag
ctcgccaccaaggcggcccgcaagagcgcgccggccaccggcggcgtgaagaagccgcac
cgctaccggcccggcacggtagctctgcgcgagatccgccgctaccagaagtccacggag
ctgttgatccgtaagctgccgttccagcggctggtgcgcgagatcgcgcaagacttcaag
actgacctgcgcttccagagctcagccgtgatggcgctgcaggaggcgtgcgaggcctat
ctggtggggctcttcgaggacaccaacctgtgtgccatccacgccaagcgcgtcaccatc
atgcccaaggacatccagcttgctcgccgcatccgcggggaaagggcataa

DBGET integrated database retrieval system