KEGG   Ovis aries (sheep): 114113021
Entry
114113021         CDS       T03117                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 2A-like isoform X1
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
oas  Ovis aries (sheep)
Pathway
oas01522  Endocrine resistance
oas01524  Platinum drug resistance
oas04110  Cell cycle
oas04115  p53 signaling pathway
oas04218  Cellular senescence
oas04934  Cushing syndrome
oas05163  Human cytomegalovirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05200  Pathways in cancer
oas05203  Viral carcinogenesis
oas05206  MicroRNAs in cancer
oas05212  Pancreatic cancer
oas05214  Glioma
oas05218  Melanoma
oas05219  Bladder cancer
oas05220  Chronic myeloid leukemia
oas05223  Non-small cell lung cancer
oas05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:oas00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114113021
   04115 p53 signaling pathway
    114113021
   04218 Cellular senescence
    114113021
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114113021
   05206 MicroRNAs in cancer
    114113021
   05203 Viral carcinogenesis
    114113021
  09162 Cancer: specific types
   05212 Pancreatic cancer
    114113021
   05225 Hepatocellular carcinoma
    114113021
   05214 Glioma
    114113021
   05220 Chronic myeloid leukemia
    114113021
   05218 Melanoma
    114113021
   05219 Bladder cancer
    114113021
   05223 Non-small cell lung cancer
    114113021
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    114113021
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    114113021
   05163 Human cytomegalovirus infection
    114113021
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    114113021
   01522 Endocrine resistance
    114113021
SSDB
Motif
Pfam: Ank_5 Ank_4 Ank_2 Ank
Other DBs
NCBI-GeneID: 114113021
NCBI-ProteinID: XP_027820389
UniProt: A0A6P7DQL7
LinkDB
Position
2
AA seq 138 aa
MQPSLGSSMETSADLLAAAAARGRADEVRALLEAGALANAPNRYGRSAIQVMMMGSARVA
ELLLLHGADPNCADPATLTRPVHDAAREGFLDTLVALHRAGARLDVRDAWGRLPVDLAEE
RGHRDVARYLRAATERRL
NT seq 417 nt   +upstreamnt  +downstreamnt
atgcagccctctttggggagcagcatggagacctcggctgacttgctggccgccgccgcc
gcgcggggccgggctgacgaggtacgggcactgctcgaggctggagcgttggccaacgcg
ccgaaccgttacggtcgaagcgcgattcaggtgatgatgatgggcagcgcccgcgtggcg
gagcttctgctgctccacggcgcggaccccaactgcgcggaccccgccaccctcacccgg
ccggtgcacgacgccgcccgggagggcttccttgacacgctggtggccctgcaccgagcc
ggggcgcggctggatgtgcgcgatgcctggggtcgcctgcccgtggacctggccgaggag
cggggccaccgcgacgtcgcccggtacctgcgcgcggccacggagagaaggctgtag

DBGET integrated database retrieval system