KEGG   Ovis aries (sheep): 443042
Entry
443042            CDS       T03117                                 

Gene name
AR
Definition
(RefSeq) androgen receptor
  KO
K08557  androgen receptor
Organism
oas  Ovis aries (sheep)
Pathway
oas04114  Oocyte meiosis
oas05200  Pathways in cancer
oas05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    443042 (AR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    443042 (AR)
  09162 Cancer: specific types
   05215 Prostate cancer
    443042 (AR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    443042 (AR)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:oas03310]
    443042 (AR)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    443042 (AR)
Nuclear receptors [BR:oas03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   443042 (AR)
SSDB
Motif
Pfam: Androgen_recep Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 443042
NCBI-ProteinID: NP_001295513
Ensembl: ENSOARG00000014525
UniProt: A0A6P9FR47 S5U7M4
LinkDB
Position
X
AA seq 890 aa
MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVCEVIQNPLPRHPEASSAAPPGARLQQQQET
SPRRQQQQQQQREDGSPQVQSRGPTGYLALEEEQQPSQHHSAPEGHPESGCVPEPRAASA
GGKGLQQPPPAPLDEDDSAAPSTLSLLGPTFPGLSSCSTDLKDILSEAGTMQLLQQQQQQ
QQEAVSEGSSGRAREATGAPVSSKDSYLGGSSTISDSAKELCKAVSVSMGLGVEALEHLS
PGEQLRGDCMYAPLLGPPAAVRPTPCAPLAECKGSLLDDGPSKGTEETAEYSPFKAGYTK
GLDTDSLGCSGSGEAGGSGTLELPSTLSLYKSGALDEVAAYQTRDYYNFPLALAGPPPPP
PPPHPHARIKLENPLDYGSAWVAAAAQCRYGDLASLHGGGAAGPGSGSPSAAASSSWHTL
FTAEEGQLYGPAVCGGGGGGSAGEAGAAAPYGYTRPPQGLASQEGDFSPPDVWYPGGVVS
RVPYPSPSCVKSEMGPWMENYSGPYGDMRLETTRDHVLPIDYYFPPQKTCLICGDEASGC
HYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGAR
KLKKLGNLKLQEEGEASSATSPTEEPAQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGH
DNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAM
GWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKA
LLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPI
ARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ
NT seq 2673 nt   +upstreamnt  +downstreamnt
atggaagtgcagttagggctggggagggtctacccccggccaccgtccaagacctatcga
ggagctttccagaacctgtttcagagtgtatgcgaagtgatccagaacccgctcccccgg
caccctgaggcctcgagcgcagcacctcccggcgcccgtttgcagcagcagcaggagacc
agtccacggcggcagcagcaacagcagcagcagagagaggatggctctccccaagtccag
agcagaggccccacaggctacctggccctggaagaggaacagcagccttcacaacatcac
tcagcccccgagggtcacccggagagtggctgcgtcccagagcccagagctgcctcggct
ggcggcaaggggctgcagcagccgccgccagcacctctggatgaggatgactcagctgcc
ccatccacgttgtccctgctgggccccactttccccggcttaagcagctgctccaccgat
cttaaagacatcctgagcgaggctggcaccatgcaacttcttcaacagcagcaacagcag
cagcaggaggcggtatccgaaggcagcagcgggagagcgagggaggccactggggctccc
gtctcttccaaggacagttacctaggaggcagttcgaccatctcggacagcgccaaggag
ttgtgtaaggcagtgtcggtgtccatgggcttgggtgtggaggcattggagcatctgagc
cctggggagcagcttcggggggattgcatgtacgccccgctcctgggtccaccagccgcg
gtgcgtcccactccttgtgcccccttggctgaatgcaaaggttctctgctggatgatggc
ccgagcaagggcactgaagagactgctgagtattcccctttcaaggcaggttacaccaaa
ggtctggacactgacagcctgggctgctctggcagcggcgaagcagggggctctggaaca
cttgagctgccatccaccctgtctctctacaagtctggagcactggacgaggtagcagct
tatcagactcgcgactactacaactttccgctagccctggccgggccgccgccccctcca
ccacctccccatccgcatgcccgcattaagctggagaacccgctggactacggcagcgcc
tgggtggccgctgcagcgcagtgccgctatggggacctggcgagcctgcatggcgggggt
gcagcaggaccgggctcaggctcaccctcagccgccgcctcctcttcctggcacactctc
ttcacggccgaagaaggccagctgtatgggccagctgtatgtggcggaggcgggggcggc
agtgcaggcgaggcaggggctgcagccccatacggctacactcggccacctcaggggctg
gcgagccaagaaggtgacttctccccacccgatgtgtggtatcccggcggcgtggtgagc
agagtgccctatccaagtcccagctgtgtcaaaagcgaaatgggcccctggatggagaac
tattctggaccttatggggacatgcgtttggagaccaccagggaccatgttctgcccatc
gactattactttccaccccagaagacctgcctaatttgtggggatgaagcttctggctgt
cactatggagctctcacttgtggaagctgcaaagtcttttttaaaagagccgctgaagga
aaacagaagtacctgtgtgccagcagaaacgattgcaccattgataaattccgaagaaaa
aattgtccatcttgtcgtctccggaaatgctatgaagcagggatgactctgggagcccgg
aaactgaagaaacttgggaatctgaagctacaggaggaaggggaggcttccagtgccacc
agccccactgaggagccagcccagaagctgacagtgtcacatattgaaggctatgagtgt
cagcccatctttctgaatgtcctggaagccattgagccaggggtggtgtgtgctggacat
gacaacaaccaacctgactccttcgcagctttactctctagcctcaatgaactgggtgaa
agacagcttgtacatgtggtcaagtgggccaaggccttgcctggcttccgcaacttgcac
gtggacgaccagatggcagtcattcagtactcctggatggggcttatggtgtttgccatg
ggctggcggtccttcaccaatgtcaactccaggatgctctactttgcccctgacctggtt
ttcaatgagtaccgcatgcacaagtcccggatgtacagccagtgtgtccgaatgaggcac
ctctcccaagaatttggatggctccaaatcacaccccaggaattcctgtgcatgaaggca
ctgctgctctttagcattattccagtggatgggctgaaaaatcaaaaattctttgatgaa
cttcgaatgaactacatcaaggaacttgatcgtatcattgcatgcaagagaaaaaatccc
acatcctgctcaaggcgcttctaccagctcaccaagctcctggactctgtgcagcctatt
gcacgagagctgcatcagttcacttttgacctgctaatcaagtctcacatggtgagcgtg
gactttccagaaatgatggcagagatcatctctgtgcaagtgcccaagatcctttccggg
aaagtcaagcctatctattttcacactcagtga

DBGET integrated database retrieval system