KEGG   Ovis aries (sheep): 443078
Entry
443078            CDS       T03117                                 

Gene name
NOS2
Definition
(RefSeq) LOW QUALITY PROTEIN: nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
oas  Ovis aries (sheep)
Pathway
oas00220  Arginine biosynthesis
oas00330  Arginine and proline metabolism
oas01100  Metabolic pathways
oas04020  Calcium signaling pathway
oas04066  HIF-1 signaling pathway
oas04146  Peroxisome
oas04371  Apelin signaling pathway
oas04926  Relaxin signaling pathway
oas05010  Alzheimer disease
oas05014  Amyotrophic lateral sclerosis
oas05022  Pathways of neurodegeneration - multiple diseases
oas05133  Pertussis
oas05140  Leishmaniasis
oas05142  Chagas disease
oas05145  Toxoplasmosis
oas05146  Amoebiasis
oas05152  Tuberculosis
oas05200  Pathways in cancer
oas05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    443078 (NOS2)
   00330 Arginine and proline metabolism
    443078 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    443078 (NOS2)
   04066 HIF-1 signaling pathway
    443078 (NOS2)
   04020 Calcium signaling pathway
    443078 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    443078 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    443078 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    443078 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    443078 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    443078 (NOS2)
   05014 Amyotrophic lateral sclerosis
    443078 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    443078 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    443078 (NOS2)
   05152 Tuberculosis
    443078 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    443078 (NOS2)
   05145 Toxoplasmosis
    443078 (NOS2)
   05140 Leishmaniasis
    443078 (NOS2)
   05142 Chagas disease
    443078 (NOS2)
Enzymes [BR:oas01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     443078 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 443078
NCBI-ProteinID: XP_012040772
Ensembl: ENSOARG00000016744
LinkDB
Position
11
AA seq 1153 aa
MRDGLGAACEAARPRLCRLLRRILRPQPACRLRRASPVTQDDPKCHSPGKHGNKSPQPLT
GTVKTSPDPLGKLDAPPSACPRHVRIKNWGSGVTFQDTLHQKAKGDLSCKSKSCLASIMN
PKSLTIGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQL
TGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHVRYATNNGNIR
SAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPASVEFTQLCIDLGWKPKFSR
FDVLPLVLQADGRDPELFEIPPDLVLEVPMEHPRYEWFQELELKWYALPAVANMLLEVGG
LEFPGCPFNGWYMGTEVGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDRAVVEINVA
VLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPISGSITPVFHQEML
NYILSPFYYYQVEAWKTHVWQDERRRPQRREIRFKVLIKAVLFASVLMQKAMSSRVRATI
LFATETGRSETLAQDLGALFSCAFNPKVLCMDQYRLSHLEEEQLLLVVTSTFGNGDSPGN
GEKLKKSLLMLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSQLGASQLAPTGEGDE
LSGQEEAFRSWAVQTFKAACETFDVSGKHHIEIPKLYTSSVTWDPHHYRLVQDSEPLDLN
KALSSMHAKPVFTMRLKSQQNLQSPKSSRTTLLVELSCEGSQAPSYLPGEHLGVFPCNQP
ALVQGILERVVDGPAPHQPMRLETLCENGSYWVKDKRLPPCSLSQALTHFLDITTPPTQL
LLRKLAQLATEEAERQRLETLCQPSDYNKWKFTNSPTFLEVLEEFPSLRVSASFLLSQLP
ILKPRYYSISSSRDLTPTEIHLTVAVLTYRTRDGQGPLHHGVCSTWLSSLKPQDPVPCFV
RSASGFQLPEDRSRPCILIGPGTGIAPFRSFWQQRLHEAEHKGLQGGRMTLVFGCRRPEE
DHLYWEEMLEMARKGVLHEVHTAYSRLPDQPKVYVQDILRQRLAGEVLRVLHEEQGHLYV
CGDVRMARDVAHSLKQLMATALSLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEMKKDGA
APSDPRAPGANTS
NT seq 3462 nt   +upstreamnt  +downstreamnt
atgcgcgacgggctgggcgccgcgtgcgaggccgcccggccccggctctgccggctcctc
cgcaggatccttcgaccgcagcccgcctgccgcctccgccgagccagtccagtgacacag
gatgaccccaaatgtcacagcccaggcaagcacgggaataagtctccccagcccctcacg
gggacggtaaagacatctccagatcccctgggcaagctggacgcacccccgtcagcctgt
ccacggcatgtgaggatcaaaaactggggcagtggagtgactttccaagacacgcttcac
cagaaggccaaaggggatctctcctgcaagtccaagtcttgcctggcatccatcatgaat
cccaaaagtttgaccataggaccccgggacaagccaacccccccagacgagcttctacct
caagctatcgaatttgtcaaccagtattatggctccttcaaagaggcaaaaatagaggaa
catctggccagggtggaagcggtaacaaaggagatagaaacaacaggaacctaccagctg
acgggagatgagctcatctttgccaccaagcaggcctggcgcaacgccccccgctgcatt
gggaggatccagtggtcgaacctgcaggtctttgacgcccggagctgttccacggcccag
gaaatgttcgaacacatctgcagacacgtgcgttacgccaccaacaacggcaacatcagg
tcggccatcaccgtgttcccccagcggagcgatgggaagcatgacttccgggtctggaat
gcccagctcatccgctatgccggctaccagatgccagatggcagcatcagaggggacccc
gccagtgtggagttcacacagctgtgcatcgacctgggctggaagcccaagttcagccgc
ttcgacgtgttgcctctagtcctgcaggctgacggccgcgacccagagctcttcgaaatc
ccccctgaccttgtgcttgaggtgcccatggaacatcccaggtacgaatggttccaggag
ctggagctcaagtggtacgccctgccagctgtggccaacatgctgcttgaggtgggcggc
ctcgagttcccagggtgccccttcaacgggtggtacatgggcacggaggttggagtccgg
gacttctgcgacgtccagcgatacaacatccttgaggaagtgggcagaaggatgggcctg
gaaacgcacaagctggcctcgctctggaaggaccgggctgtcgttgagatcaacgtcgct
gtgctccacagcttccagaagcagaacgtgaccatcatggaccaccactccgctgcggag
tccttcatgaagtacatgcagaacgagtaccgctcccgagggggctgcccagctgactgg
atttggctggtcccgccgatttctggaagcatcacccccgtgttccaccaggaaatgcta
aattacatcctgtcccctttctactactaccaggtggaggcctggaaaacccacgtctgg
caggacgagaggcggaggccccagagaagagagattcgattcaaggtcttgatcaaagcc
gtgctcttcgcctcggtgctgatgcagaaggccatgtcatcccgggtcagagccacgatc
ctctttgcaacagagacggggagatcggaaacgctggcccaagaccttggggctttgttc
agctgtgccttcaaccccaaggttctctgcatggatcagtaccggctgagccatctggag
gaggaacagctgctgctggtggtgaccagcacttttggcaacggagactcccctggcaac
ggagagaaactgaagaagtccctcttgatgctgaaagaactcaccaacaagttccggtac
gccgtgtttggccttggctccagcatgtaccctcagttctgtgcttttgctcacgacatc
gaccagaagttgtcccagctgggggcttctcagcttgccccaactggggaaggggacgaa
ctcagcgggcaggaggaggccttccgcagctgggccgtgcaaaccttcaaggcagcctgt
gagacattcgatgtcagtggcaagcaccacattgagatccccaagctctacacttccagt
gtgacctgggacccacaccactacaggctcgtgcaggactcagagcctctggacctcaac
aaagccctgagcagtatgcacgccaagcctgtgttcaccatgaggctcaaatcgcagcag
aatctgcagagtccgaaatccagccgcaccaccctcctggtggaactctcctgtgagggc
agccaagctccaagctacctgccgggagagcacctcggagttttcccatgcaaccagcca
gccctggttcaaggcatccttgagcgagtggtggatggccctgccccgcaccagcccatg
cgcctggagaccctctgtgagaatggcagctactgggtcaaggataagcgactgccacct
tgctcactcagccaggctctcacccatttcctggacatcaccaccccgccaacccagctg
ctgcttcgaaagctggcccagctggccacagaagaggctgagaggcagaggctggagacc
ctatgccagccctcagattacaacaagtggaagttcaccaacagccccacattcctggag
gtgctggaggaattcccgtccctgcgggtatctgccagcttcctgctctcccagctccct
attctgaagccccggtactactccatcagctcctccagggacctcacacccacggagatc
cacctcactgtggccgtgctcacgtaccgcacccgagatggccaaggtcccctgcaccat
ggcgtctgcagcacgtggctcagcagcttgaagccccaggacccggtgccctgctttgtg
cgaagtgccagcggcttccagcttcccgaggaccgctcccgtccttgcatcctcatcggg
cccggcacgggcatcgcccccttccgcagtttctggcagcagcggctccatgaggctgag
cacaaagggctccagggcggccgcatgaccctggtttttgggtgccgccgcccggaagag
gaccacctctactgggaggagatgctggagatggcccgcaagggggtgctgcatgaggtg
cacacagcctattcccgcctgcctgaccagcccaaggtctatgttcaagacatcctgcgg
cagcggctggcgggtgaggtgcttcgtgtgctccatgaagagcaaggccacctctatgtc
tgcggggacgtgcgcatggcccgggacgtggcccacagcctgaagcagctgatggctact
gcgctgagcctgaatgaggaacaggtggaggactatttcttccagctcaagagccagaag
cgctatcatgaagacatctttggtgctgtatttccctatgagatgaaaaaggatggggca
gcgcccagcgatcccagagctccaggcgccaacacaagttaa

DBGET integrated database retrieval system