KEGG   Ovis aries (sheep): 443094Help
Entry
443094            CDS       T03117                                 

Gene name
PRKACA
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
oas  Ovis aries (sheep)
Pathway
oas01522  Endocrine resistance
oas04010  MAPK signaling pathway
oas04014  Ras signaling pathway
oas04020  Calcium signaling pathway
oas04024  cAMP signaling pathway
oas04062  Chemokine signaling pathway
oas04114  Oocyte meiosis
oas04140  Autophagy - animal
oas04211  Longevity regulating pathway
oas04213  Longevity regulating pathway - multiple species
oas04261  Adrenergic signaling in cardiomyocytes
oas04270  Vascular smooth muscle contraction
oas04310  Wnt signaling pathway
oas04340  Hedgehog signaling pathway
oas04371  Apelin signaling pathway
oas04530  Tight junction
oas04540  Gap junction
oas04611  Platelet activation
oas04713  Circadian entrainment
oas04714  Thermogenesis
oas04720  Long-term potentiation
oas04723  Retrograde endocannabinoid signaling
oas04724  Glutamatergic synapse
oas04725  Cholinergic synapse
oas04726  Serotonergic synapse
oas04727  GABAergic synapse
oas04728  Dopaminergic synapse
oas04740  Olfactory transduction
oas04742  Taste transduction
oas04750  Inflammatory mediator regulation of TRP channels
oas04910  Insulin signaling pathway
oas04911  Insulin secretion
oas04912  GnRH signaling pathway
oas04913  Ovarian steroidogenesis
oas04914  Progesterone-mediated oocyte maturation
oas04915  Estrogen signaling pathway
oas04916  Melanogenesis
oas04918  Thyroid hormone synthesis
oas04919  Thyroid hormone signaling pathway
oas04921  Oxytocin signaling pathway
oas04922  Glucagon signaling pathway
oas04923  Regulation of lipolysis in adipocytes
oas04924  Renin secretion
oas04925  Aldosterone synthesis and secretion
oas04926  Relaxin signaling pathway
oas04927  Cortisol synthesis and secretion
oas04928  Parathyroid hormone synthesis, secretion and action
oas04934  Cushing syndrome
oas04961  Endocrine and other factor-regulated calcium reabsorption
oas04962  Vasopressin-regulated water reabsorption
oas04970  Salivary secretion
oas04971  Gastric acid secretion
oas04976  Bile secretion
oas05012  Parkinson disease
oas05020  Prion diseases
oas05030  Cocaine addiction
oas05031  Amphetamine addiction
oas05032  Morphine addiction
oas05146  Amoebiasis
oas05163  Human cytomegalovirus infection
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05200  Pathways in cancer
oas05203  Viral carcinogenesis
oas05205  Proteoglycans in cancer
oas05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    443094 (PRKACA)
   04010 MAPK signaling pathway
    443094 (PRKACA)
   04310 Wnt signaling pathway
    443094 (PRKACA)
   04340 Hedgehog signaling pathway
    443094 (PRKACA)
   04371 Apelin signaling pathway
    443094 (PRKACA)
   04020 Calcium signaling pathway
    443094 (PRKACA)
   04024 cAMP signaling pathway
    443094 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    443094 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    443094 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    443094 (PRKACA)
   04540 Gap junction
    443094 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    443094 (PRKACA)
   04062 Chemokine signaling pathway
    443094 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    443094 (PRKACA)
   04910 Insulin signaling pathway
    443094 (PRKACA)
   04922 Glucagon signaling pathway
    443094 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    443094 (PRKACA)
   04912 GnRH signaling pathway
    443094 (PRKACA)
   04913 Ovarian steroidogenesis
    443094 (PRKACA)
   04915 Estrogen signaling pathway
    443094 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    443094 (PRKACA)
   04921 Oxytocin signaling pathway
    443094 (PRKACA)
   04926 Relaxin signaling pathway
    443094 (PRKACA)
   04918 Thyroid hormone synthesis
    443094 (PRKACA)
   04919 Thyroid hormone signaling pathway
    443094 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    443094 (PRKACA)
   04916 Melanogenesis
    443094 (PRKACA)
   04924 Renin secretion
    443094 (PRKACA)
   04925 Aldosterone synthesis and secretion
    443094 (PRKACA)
   04927 Cortisol synthesis and secretion
    443094 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    443094 (PRKACA)
   04270 Vascular smooth muscle contraction
    443094 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    443094 (PRKACA)
   04971 Gastric acid secretion
    443094 (PRKACA)
   04976 Bile secretion
    443094 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    443094 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    443094 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    443094 (PRKACA)
   04727 GABAergic synapse
    443094 (PRKACA)
   04725 Cholinergic synapse
    443094 (PRKACA)
   04728 Dopaminergic synapse
    443094 (PRKACA)
   04726 Serotonergic synapse
    443094 (PRKACA)
   04720 Long-term potentiation
    443094 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    443094 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    443094 (PRKACA)
   04742 Taste transduction
    443094 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    443094 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    443094 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    443094 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    443094 (PRKACA)
   04714 Thermogenesis
    443094 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    443094 (PRKACA)
   05205 Proteoglycans in cancer
    443094 (PRKACA)
   05203 Viral carcinogenesis
    443094 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    443094 (PRKACA)
   05020 Prion diseases
    443094 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    443094 (PRKACA)
   05031 Amphetamine addiction
    443094 (PRKACA)
   05032 Morphine addiction
    443094 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    443094 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    443094 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    443094 (PRKACA)
   05163 Human cytomegalovirus infection
    443094 (PRKACA)
   05165 Human papillomavirus infection
    443094 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    443094 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    443094 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    443094 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:oas03019]
    443094 (PRKACA)
   03036 Chromosome and associated proteins [BR:oas03036]
    443094 (PRKACA)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     443094 (PRKACA)
Protein kinases [BR:oas01001]
 Serine/threonine kinases: AGC group
  PKA family
   443094 (PRKACA)
Messenger RNA biogenesis [BR:oas03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     443094 (PRKACA)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    443094 (PRKACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 443094
NCBI-ProteinID: NP_001009234
Ensembl: ENSOARG00000006476
UniProt: Q9MZD9
LinkDB All DBs
Position
5
AA seq 351 aa AA seqDB search
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHTETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgccgccgccgccaagaagggcagtgagcaagagagcgtgaaagagttctta
gccaaagccaaagaagattttcttaaaaaatgggaaaatcctgctcagaacacagcccac
ttggatcagtttgaacgaattaagaccctgggcacgggctccttcgggcgggtgatgctg
gtgaagcacacggagaccgggaaccactacgccatgaagatcctcgacaaacagaaggtg
gtgaagctgaaacagattgagcacaccctgaacgagaagcgcatcctgcaggcggtcaac
tttccgttccttgtcaaactcgagttctccttcaaggacaactcaaatttatacatggtc
atggagtacgtgcccggtggggagatgttctcacacctgcgacggatcgggaggttcagt
gagccccacgcgcgcttctacgccgcccagattgtcctgacctttgagtacctgcactcg
cttgatctcatctaccgggacctgaagccggagaacctcctcattgaccagcagggctac
attcaggtgacagacttcggtttcgccaagcgtgtgaaaggccgcacctggaccttgtgt
gggacccccgagtacctggcccccgagatcatcctgagtaaaggctacaacaaagctgtg
gactggtgggccctgggggtcctcatctatgaaatggccgcaggctacccgcccttcttc
gccgaccagcccatccagatctacgagaagattgtctctgggaaggtgcggtttccatcc
cacttcagctctgacttgaaggatctgctgcgcaacctcctacaagtggacctcaccaag
cgctttgggaacctcaagaatggggtcaatgatataaagaaccacaagtggtttgccaca
actgactggattgccatctaccagagaaaggtggaagctcccttcataccaaagtttaaa
ggccctggggacacaagtaactttgacgactatgaggaggaagagatccgagtctccatc
aatgagaagtgtggcaaggagttttctgagttctag

DBGET integrated database retrieval system