KEGG   Ovis aries (sheep): 443103
Entry
443103            CDS       T03117                                 

Gene name
VEGFA
Definition
(RefSeq) vascular endothelial growth factor A precursor
  KO
K05448  vascular endothelial growth factor A
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas04010  MAPK signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04020  Calcium signaling pathway
oas04066  HIF-1 signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04370  VEGF signaling pathway
oas04510  Focal adhesion
oas04926  Relaxin signaling pathway
oas04933  AGE-RAGE signaling pathway in diabetic complications
oas05163  Human cytomegalovirus infection
oas05165  Human papillomavirus infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05200  Pathways in cancer
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05211  Renal cell carcinoma
oas05212  Pancreatic cancer
oas05219  Bladder cancer
oas05323  Rheumatoid arthritis
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    443103 (VEGFA)
   04014 Ras signaling pathway
    443103 (VEGFA)
   04015 Rap1 signaling pathway
    443103 (VEGFA)
   04370 VEGF signaling pathway
    443103 (VEGFA)
   04066 HIF-1 signaling pathway
    443103 (VEGFA)
   04020 Calcium signaling pathway
    443103 (VEGFA)
   04151 PI3K-Akt signaling pathway
    443103 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    443103 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    443103 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    443103 (VEGFA)
   05206 MicroRNAs in cancer
    443103 (VEGFA)
   05205 Proteoglycans in cancer
    443103 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    443103 (VEGFA)
   05211 Renal cell carcinoma
    443103 (VEGFA)
   05219 Bladder cancer
    443103 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    443103 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    443103 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    443103 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    443103 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    443103 (VEGFA)
   05165 Human papillomavirus infection
    443103 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    443103 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oas04052]
    443103 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:oas00536]
    443103 (VEGFA)
Cytokines and growth factors [BR:oas04052]
 Growth factors
  Growth factors (RTK binding)
   443103 (VEGFA)
Glycosaminoglycan binding proteins [BR:oas00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   443103 (VEGFA)
SSDB
Motif
Pfam: PDGF DUF779
Other DBs
NCBI-GeneID: 443103
NCBI-ProteinID: NP_001020281
Ensembl: ENSOARG00000008334
UniProt: P50412
LinkDB
Position
20
AA seq 146 aa
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGQKPHEVMKFMDVYQRSFCRPIETLVDI
FQEYPDEIEFIFKPSCVPLMRCGGCCNDESLECVPTEEFNITMQIMRIKPHQSQHIGEMS
FLQHNKCECRPKKDKARQEKCDKPRR
NT seq 441 nt   +upstreamnt  +downstreamnt
atgaactttctgctctcttgggtgcattggagccttgccttgctgctctaccttcaccat
gccaagtggtcccaggctgcacccatggcagaaggagggcagaaaccccatgaagtgatg
aagttcatggatgtctaccagcgcagcttctgccgtcccattgagaccctggtggacatc
ttccaggagtacccagatgagattgagttcattttcaagccgtcctgtgtgcccctgatg
cggtgcgggggctgctgtaatgacgaaagtctggagtgtgtgcccactgaggagttcaac
atcaccatgcagattatgcggatcaaacctcaccaaagccagcacataggagagatgagt
ttcctacagcataacaaatgtgaatgcagaccaaagaaagataaagcaaggcaagaaaaa
tgtgacaagccgaggcggtga

DBGET integrated database retrieval system