KEGG   Ovis aries (sheep): 443302
Entry
443302            CDS       T03117                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin precursor
  KO
K05437  erythropoietin
Organism
oas  Ovis aries (sheep)
Pathway
oas04060  Cytokine-cytokine receptor interaction
oas04066  HIF-1 signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04630  JAK-STAT signaling pathway
oas04640  Hematopoietic cell lineage
oas05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    443302 (EPO)
   04066 HIF-1 signaling pathway
    443302 (EPO)
   04151 PI3K-Akt signaling pathway
    443302 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    443302 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    443302 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    443302 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oas04052]
    443302 (EPO)
Cytokines and growth factors [BR:oas04052]
 Cytokines
  CSF and other factors
   443302 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 443302
NCBI-ProteinID: NP_001019908
UniProt: P33709
LinkDB
Position
24
AA seq 194 aa
MGARDCTPLLLLLLSFLLFPLGLPVLGAPPRLICDSRVLERYILEAREAENATMGCAEGC
SFSENITVPDTKVNFYAWKRMEVQQQALEVWQGLALLSEAIFRGQALLANASQPCEALRL
HVDKAVSGLRSLTSLLRALGAQKEAIPLPDATPSAAPLRIFTVDALSKLFRIYSNFLRGK
LTLYTGEACRRGDR
NT seq 585 nt   +upstreamnt  +downstreamnt
atgggggcgcgcgactgtactccgctgctgctgctgctgctgtcttttctgctgtttcct
ctgggcctcccagtcttgggcgcccccccacgcctcatctgtgacagccgagtcctggag
aggtacatcctggaggccagggaggccgaaaatgccacgatgggctgtgcagaaggctgc
agcttcagtgagaatatcactgtcccagacaccaaggttaacttctatgcctggaagagg
atggaggtccagcagcaggctctggaagtctggcagggcctggctctgctctcagaagct
atctttcggggccaggccctactggccaacgcatcccagccatgcgaggccctgcggctg
cacgtggacaaagctgtcagcggcctccgcagtctcacctccctgcttcgggcgctggga
gcccagaaagaagccatcccccttccagatgcaaccccctccgcagccccactccgaata
ttcactgttgatgctttgtccaagctcttccgaatctactccaatttcctgaggggaaag
ctgacgctgtacacaggggaggcctgcaggagaggggacaggtga

DBGET integrated database retrieval system