KEGG   Ovis aries (sheep): 443371
Entry
443371            CDS       T03117                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand precursor
  KO
K05461  KIT ligand
Organism
oas  Ovis aries (sheep)
Pathway
oas04010  MAPK signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04072  Phospholipase D signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04640  Hematopoietic cell lineage
oas04916  Melanogenesis
oas05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    443371 (KITLG)
   04014 Ras signaling pathway
    443371 (KITLG)
   04015 Rap1 signaling pathway
    443371 (KITLG)
   04072 Phospholipase D signaling pathway
    443371 (KITLG)
   04151 PI3K-Akt signaling pathway
    443371 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    443371 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    443371 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    443371 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oas04052]
    443371 (KITLG)
Cytokines and growth factors [BR:oas04052]
 Growth factors
  Growth factors (RTK binding)
   443371 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 443371
NCBI-ProteinID: NP_001254817
Ensembl: ENSOARG00000015592
UniProt: G8Z9W6
LinkDB
Position
3
AA seq 181 aa
MKKTQTWIITCIYLQLLLFNPLVHTQGICRNRVTDDVKDVTKLVANLPKDYMITLKYVPG
MDVLPSHCWISEMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECMEEHSF
ENVKKSSKSPEPRQFTPEKFFGIFNKSIDAFKDLEIVASTMSECVISSTSSPEKGKTYKH
S
NT seq 546 nt   +upstreamnt  +downstreamnt
atgaagaaaacacaaacttggattatcacttgcatttatcttcaactgctcctatttaat
cctctggtccacactcaagggatctgccggaaccgtgtgactgatgatgtgaaagacgtt
acaaaattggtggcaaatcttccaaaagactatatgataaccctcaaatatgtccccggg
atggacgttttgcctagtcattgttggataagtgagatggtggaacaactgtcagtcagc
ttgactgatcttctggacaagttttcaaatatttctgaaggcttgagcaattattctatc
atagacaaacttgtgaaaatagttgatgaccttgtggagtgcatggaagaacactcattt
gagaatgtaaaaaaatcatctaagagcccagaacccaggcagtttactcctgagaaattc
tttggaatttttaataaatccattgatgccttcaaggacttggagatagtggcttctaca
atgagtgaatgtgtgatttcctcaacatcaagtcctgaaaaaggtaagacatacaagcat
tcctaa

DBGET integrated database retrieval system