KEGG   Ovis aries (sheep): 443387Help
Entry
443387            CDS       T03117                                 

Gene name
FSHB
Definition
(RefSeq) follitropin subunit beta precursor
  KO
K05250  follitropin subunit beta
Organism
oas  Ovis aries (sheep)
Pathway
oas04024  cAMP signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04912  GnRH signaling pathway
oas04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    443387 (FSHB)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    443387 (FSHB)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    443387 (FSHB)
   04913 Ovarian steroidogenesis
    443387 (FSHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cys_knot
Motif
Other DBs
NCBI-GeneID: 443387
NCBI-ProteinID: NP_001009798
Ensembl: ENSOARG00000015425
UniProt: P01227
LinkDB All DBs
Position
15
AA seq 129 aa AA seqDB search
MKSVQFCFLFCCWRAICCRSCELTNITITVEKEECSFCISINTTWCAGYCYTRDLVYKDP
ARPNIQKACTFKELVYETVKVPGCAHHADSLYTYPVATECHCGKCDRDSTDCTVRGLGPS
YCSFSDIRE
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccgtccagttctgcttccttttctgttgctggagagcaatctgctgcagaagc
tgcgagctgaccaacatcaccatcacggtggagaaagaggaatgtagcttctgcataagc
atcaacaccacgtggtgtgcaggctattgctacacccgggacttggtgtacaaggaccca
gcgaggcccaacatccagaaagcatgtaccttcaaggagctggtgtacgagacggtgaaa
gtgcctggctgtgcccaccatgcagactccctgtacacgtacccagtagccactgaatgt
cactgcggcaagtgtgaccgcgacagcactgactgcaccgtgcgaggcctggggcccagc
tactgctccttcagtgacatcagagaataa

KEGG   Ovis aries (sheep): 443538Help
Entry
443538            CDS       T03117                                 

Gene name
CGA
Definition
(RefSeq) glycoprotein hormones alpha chain precursor
  KO
K08522  glycoprotein hormones alpha chain
Organism
oas  Ovis aries (sheep)
Pathway
oas04024  cAMP signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04912  GnRH signaling pathway
oas04913  Ovarian steroidogenesis
oas04917  Prolactin signaling pathway
oas04918  Thyroid hormone synthesis
oas04923  Regulation of lipolysis in adipocytes
oas05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    443538 (CGA)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    443538 (CGA)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    443538 (CGA)
   04912 GnRH signaling pathway
    443538 (CGA)
   04913 Ovarian steroidogenesis
    443538 (CGA)
   04917 Prolactin signaling pathway
    443538 (CGA)
   04918 Thyroid hormone synthesis
    443538 (CGA)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    443538 (CGA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_6 PDGF
Motif
Other DBs
NCBI-GeneID: 443538
NCBI-ProteinID: NP_001009464
Ensembl: ENSOARG00000013153
UniProt: P01218
LinkDB All DBs
Position
8
AA seq 120 aa AA seqDB search
MDYYRKYAAAILAILSLFLQILHSFPDGEFTMQGCPECKLKENKYFSKPDAPIYQCMGCC
FSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNVRVENHTECHCSTCYYHKS
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggattactacagaaagtatgcagctgccattctggccatattgtctctgtttctgcaa
attctccattcctttcctgatggagagtttacaatgcagggttgtcctgaatgcaagcta
aaagaaaacaaatacttctccaagccagatgctccaatttatcagtgcatggggtgctgc
ttctccagggcataccccactccagcgaggtctaagaagacaatgttggttcccaagaac
atcacctcggaagccacatgttgtgtggccaaagcatttaccaaggccacagtgatggga
aatgtcagagtggagaaccacaccgagtgccactgcagtacttgttattatcacaaatct
taa

DBGET integrated database retrieval system