KEGG   Ovis aries (sheep): 443390Help
Entry
443390            CDS       T03117                                 

Gene name
OXT
Definition
(RefSeq) oxytocin-neurophysin 1 precursor
  KO
K05243  oxytocin-neurophysin 1
Organism
oas  Ovis aries (sheep)
Pathway
oas04024  cAMP signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    443390 (OXT)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    443390 (OXT)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    443390 (OXT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_5 Hormone_4
Motif
Other DBs
NCBI-GeneID: 443390
NCBI-ProteinID: NP_001009801
UniProt: P13389
LinkDB All DBs
Position
13
AA seq 125 aa AA seqDB search
MAGSSLACCLLGLLALTSACYIQNCPLGGKRAVLDLDVRTCLPCGPGAKGRCFGPSICCG
DELGCFVGTAEALRCREENYLPSPCQSGQKPCGSGGRCAAAGICCSPDGSHADPACDPEA
AFSQH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggcaggttccagcctcgcctgctgcctgctcggcctcctggcgttgacctccgcctgc
tacattcagaactgccccctgggcggcaagcgtgcggtgctggacctcgacgtgcgcacg
tgtctcccctgcggccccggggcgaaaggccgctgcttcgggcccagcatctgctgcggg
gacgagctgggctgcttcgtgggcacggccgaggcgctgcgctgccgagaggagaactac
ctgccgtcgccctgccagtccggccagaagccctgcgggagcgggggccgctgcgccgcc
gccgggatctgctgcagcccggacggctcgcacgcggatcctgcctgcgaccccgaggcc
gccttctcccagcactga

DBGET integrated database retrieval system