KEGG   Ovis aries (sheep): 443401
Entry
443401            CDS       T03117                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2 precursor
  KO
K05429  interleukin 2
Organism
oas  Ovis aries (sheep)
Pathway
oas04060  Cytokine-cytokine receptor interaction
oas04061  Viral protein interaction with cytokine and cytokine receptor
oas04151  PI3K-Akt signaling pathway
oas04625  C-type lectin receptor signaling pathway
oas04630  JAK-STAT signaling pathway
oas04658  Th1 and Th2 cell differentiation
oas04659  Th17 cell differentiation
oas04660  T cell receptor signaling pathway
oas04672  Intestinal immune network for IgA production
oas04940  Type I diabetes mellitus
oas05135  Yersinia infection
oas05142  Chagas disease
oas05162  Measles
oas05166  Human T-cell leukemia virus 1 infection
oas05200  Pathways in cancer
oas05320  Autoimmune thyroid disease
oas05321  Inflammatory bowel disease
oas05330  Allograft rejection
oas05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    443401 (IL2)
   04151 PI3K-Akt signaling pathway
    443401 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    443401 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    443401 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    443401 (IL2)
   04660 T cell receptor signaling pathway
    443401 (IL2)
   04658 Th1 and Th2 cell differentiation
    443401 (IL2)
   04659 Th17 cell differentiation
    443401 (IL2)
   04672 Intestinal immune network for IgA production
    443401 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    443401 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    443401 (IL2)
   05321 Inflammatory bowel disease
    443401 (IL2)
   05330 Allograft rejection
    443401 (IL2)
   05332 Graft-versus-host disease
    443401 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    443401 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    443401 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    443401 (IL2)
   05162 Measles
    443401 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    443401 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oas04052]
    443401 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:oas00536]
    443401 (IL2)
Cytokines and growth factors [BR:oas04052]
 Cytokines
  Interleukins
   443401 (IL2)
Glycosaminoglycan binding proteins [BR:oas00536]
 Heparan sulfate / Haparin
  Cytokines
   443401 (IL2)
SSDB
Motif
Pfam: IL2 DUF922
Other DBs
NCBI-GeneID: 443401
NCBI-ProteinID: NP_001009806
UniProt: P19114
LinkDB
Position
17
AA seq 155 aa
MYKIQPLSCIALTLALVANGAPTSSSTGNTMKEVKSLLLDLQLLLEKVKNPENLKLSRMH
TFNFYMPKVNATELKHLKCLLEELKLLEEVLDLAPSKNLNTREIKDSMDNIKRIVLELQG
SETRFTCEYDDATVKAVEFLNKWITFCQSIYSTMT
NT seq 468 nt   +upstreamnt  +downstreamnt
atgtacaagatacaacccttgtcttgcattgcactaactcttgcactcgttgcaaacggt
gcacctacttcaagctctacggggaacacaatgaaagaagtgaagtcattgctgctagat
ttacagttgcttttggagaaagttaaaaatcccgagaacctcaagctctccaggatgcat
acatttaacttctacatgcccaaggttaacgctacagaattgaaacatcttaagtgttta
ctagaagaactcaaacttctagaggaagtgctagatttagctccaagcaaaaacctgaac
accagagagatcaaggattcaatggacaatatcaagagaatagttttggaactacaggga
tctgaaacaagattcacatgtgaatatgatgatgcgacagtaaaggctgtagaatttctg
aacaaatggattaccttttgtcaaagcatctactcaacaatgacttga

DBGET integrated database retrieval system