KEGG   Ovis aries (sheep): 443412
Entry
443412            CDS       T03117                                 

Gene name
NR3C1
Definition
(RefSeq) glucocorticoid receptor
  KO
K05771  glucocorticoid receptor
Organism
oas  Ovis aries (sheep)
Pathway
oas04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    443412 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    443412 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:oas03310]
    443412 (NR3C1)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    443412 (NR3C1)
Nuclear receptors [BR:oas03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   443412 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 443412
NCBI-ProteinID: NP_001107658
Ensembl: ENSOARG00000002045
UniProt: B0LSR5
LinkDB
Position
5
AA seq 781 aa
MDPKESLSTPSREEIPSSVLGRERGNVMDFYKTLRGGATVKVSASSPSLAAASQSDSKQQ
RLLVDFPKGSGSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDF
RLLEESIANLNRSTSVPENPKNSASAAVSAAPTEKEFPKTHSDVSSEQQNLKGQKGSNGG
NMKLYTTDQSTFDIWRKKLQDLEFSSESPSKETSDSPWRSDILIDENCLLSPLAGEDDSF
LLEGSSNEDCKPLLLPDTKPKIKDNGDLILPSPNSVPLPQVKTEKEDFIELCTPGVIKQE
KLGPVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIP
PIPVGSENWNRCQGSGDDNLTSLGTLNFSGRSVFSNGYSSPGMRPDVSSPPSSSSAATGP
PPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPAC
RYRKCLQAGMNLEARKTKKKIKGIQQAPTGVSQETSENPANKTIVPATLPQLTPTLVSLL
EVIEPEVLYAGYDSSVPDSTWRIMTALNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLL
QYSWMFLMAFALGWRSYRQSSANMLCFAPDLVINEQRMALPCMYDQCKHMLYVSSELSRL
QVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFY
QLTKLLDSMHDVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSSGNIKKLLFHQ
K
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggaccccaaggagtcattaagcacccccagtagagaagaaatccccagcagtgtgctt
ggtcgagagaggggaaatgtgatggacttctataaaaccctaaggggaggagctactgtg
aaggtttctgcatcttctccctcactggctgctgcttctcagtcagactccaagcagcaa
agacttctggttgattttccaaaaggctcaggaagcaatgcgcagcagccagatctgtcc
aaggcagtttcactgtcaatgggactgtacatgggagagacagagacaaaagtgatggga
aatgacctgggattcccacagcagggccaaatcagcctttcctctggggaaacagacttt
cggcttctggaagaaagcatcgcaaacctcaataggtcaaccagtgttccagagaacccc
aagaattctgcatccgctgctgtctctgctgcccccacagagaaggagtttccaaaaact
cactctgatgtgtcttcagaacagcagaatttgaaaggccagaagggcagtaacgggggt
aatatgaagttgtataccacagaccaaagcacctttgacatttggaggaaaaagctccag
gatttggagttttcttctgagtccccaagtaaagagacaagtgacagtccttggagatca
gacatcttgatagatgaaaactgtttgctttctcctttggcaggagaggatgattcattc
cttctggaaggaagctcgaatgaggactgtaagcctcttcttttaccggacactaagcct
aaaattaaagataatggagatttgatcttaccaagtcctaacagtgtgccactgccccaa
gtgaaaacagaaaaagaagattttatcgaactctgcacccctggggtaattaagcaggag
aaactgggcccagtttattgtcaggccagctttcctggggccaacataattggcaataaa
atgtctgccatttctgttcatggtgtgagtacctctgggggacagatgtaccactacgac
atgaacacagcatccctttctcaacagcaggatcagaaacctatttttaatgtcattcca
ccaattcctgttggttcagaaaattggaatagatgccaagggtctggagatgacaacttg
acttccttggggactttgaacttctctggtcgatctgttttttctaacggctattcaagc
cctggaatgagaccagacgtaagctctcctccatccagttcctcagcagctacgggacca
cctcccaaactctgcctagtctgctctgatgaagcttcgggatgtcattatggggtcttg
acttgtggaagctgtaaagtattcttcaaaagagcagtggaaggacagcacaattatctt
tgtgctggaagaaatgattgtatcattgataaaattcgaagaaaaaactgcccagcatgc
cgctatagaaaatgtcttcaagctggaatgaacctggaagctcgaaaaacaaagaaaaag
ataaaaggaattcagcaggcccctacaggagtctcgcaagaaacttctgaaaatcctgct
aacaaaacaatagttcctgcaacattaccacaactcacgcccacgctggtgtcactgctg
gaagtcattgaacccgaggtgttatatgcaggatatgacagctctgttccagattcaact
tggcggatcatgaccgcactcaacatgttaggtgggcggcaggtgattgcagcagtgaaa
tgggcaaaggcaataccaggattcaggaacttacatctggatgaccaaatgactctgctg
caatattcatggatgttcctcatggcgtttgccctgggctggagatcatacagacagtca
agcgcaaatatgctgtgttttgctcctgatctggttattaatgagcagagaatggcttta
ccctgcatgtatgaccaatgtaaacatatgctatatgtttcctctgagttaagcaggctt
caggtatcttacgaagagtatctctgtatgaaaaccttactgctcctctcttcagttcct
aaggaaggcttgaagagtcaagaactatttgatgaaattagaatgacctacatcaaagag
ctaggaaaagccattgtcaagagggaaggaaactccagtcagaactggcagcggttttat
caactgacaaaactcttggactccatgcatgatgtggttgaaaatcttcttaactattgc
ttccaaacatttttggataagactatgagtattgaattcccagagatgttagctgaaatc
atcaccaatcagataccaaaatattcaagtggaaatatcaaaaaacttctgtttcatcaa
aagtga

DBGET integrated database retrieval system