KEGG   Ovis aries (sheep): 443421
Entry
443421            CDS       T03117                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
oas  Ovis aries (sheep)
Pathway
oas01522  Endocrine resistance
oas01524  Platinum drug resistance
oas04010  MAPK signaling pathway
oas04071  Sphingolipid signaling pathway
oas04110  Cell cycle
oas04115  p53 signaling pathway
oas04137  Mitophagy - animal
oas04151  PI3K-Akt signaling pathway
oas04210  Apoptosis
oas04211  Longevity regulating pathway
oas04216  Ferroptosis
oas04218  Cellular senescence
oas04310  Wnt signaling pathway
oas04722  Neurotrophin signaling pathway
oas04919  Thyroid hormone signaling pathway
oas05012  Parkinson disease
oas05014  Amyotrophic lateral sclerosis
oas05016  Huntington disease
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05162  Measles
oas05163  Human cytomegalovirus infection
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05168  Herpes simplex virus 1 infection
oas05169  Epstein-Barr virus infection
oas05200  Pathways in cancer
oas05202  Transcriptional misregulation in cancer
oas05203  Viral carcinogenesis
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05210  Colorectal cancer
oas05212  Pancreatic cancer
oas05213  Endometrial cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05216  Thyroid cancer
oas05217  Basal cell carcinoma
oas05218  Melanoma
oas05219  Bladder cancer
oas05220  Chronic myeloid leukemia
oas05222  Small cell lung cancer
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05230  Central carbon metabolism in cancer
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    443421 (TP53)
   04310 Wnt signaling pathway
    443421 (TP53)
   04071 Sphingolipid signaling pathway
    443421 (TP53)
   04151 PI3K-Akt signaling pathway
    443421 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    443421 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    443421 (TP53)
   04210 Apoptosis
    443421 (TP53)
   04216 Ferroptosis
    443421 (TP53)
   04115 p53 signaling pathway
    443421 (TP53)
   04218 Cellular senescence
    443421 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    443421 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    443421 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    443421 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    443421 (TP53)
   05202 Transcriptional misregulation in cancer
    443421 (TP53)
   05206 MicroRNAs in cancer
    443421 (TP53)
   05205 Proteoglycans in cancer
    443421 (TP53)
   05203 Viral carcinogenesis
    443421 (TP53)
   05230 Central carbon metabolism in cancer
    443421 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    443421 (TP53)
   05212 Pancreatic cancer
    443421 (TP53)
   05225 Hepatocellular carcinoma
    443421 (TP53)
   05226 Gastric cancer
    443421 (TP53)
   05214 Glioma
    443421 (TP53)
   05216 Thyroid cancer
    443421 (TP53)
   05220 Chronic myeloid leukemia
    443421 (TP53)
   05217 Basal cell carcinoma
    443421 (TP53)
   05218 Melanoma
    443421 (TP53)
   05219 Bladder cancer
    443421 (TP53)
   05215 Prostate cancer
    443421 (TP53)
   05213 Endometrial cancer
    443421 (TP53)
   05224 Breast cancer
    443421 (TP53)
   05222 Small cell lung cancer
    443421 (TP53)
   05223 Non-small cell lung cancer
    443421 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    443421 (TP53)
   05014 Amyotrophic lateral sclerosis
    443421 (TP53)
   05016 Huntington disease
    443421 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    443421 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    443421 (TP53)
   05161 Hepatitis B
    443421 (TP53)
   05160 Hepatitis C
    443421 (TP53)
   05162 Measles
    443421 (TP53)
   05168 Herpes simplex virus 1 infection
    443421 (TP53)
   05163 Human cytomegalovirus infection
    443421 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    443421 (TP53)
   05169 Epstein-Barr virus infection
    443421 (TP53)
   05165 Human papillomavirus infection
    443421 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    443421 (TP53)
   01522 Endocrine resistance
    443421 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    443421 (TP53)
   03036 Chromosome and associated proteins [BR:oas03036]
    443421 (TP53)
   03400 DNA repair and recombination proteins [BR:oas03400]
    443421 (TP53)
Transcription factors [BR:oas03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    443421 (TP53)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     443421 (TP53)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    443421 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD
Other DBs
NCBI-GeneID: 443421
NCBI-ProteinID: NP_001009403
Ensembl: ENSOARG00000015571
UniProt: P51664
LinkDB
Position
11
AA seq 382 aa
MEESQAELGVEPPLSQETFSDLWNLLPENNLLSSELSAPVDDLLPYSEDVVTWLDECPNE
APQMPEPPAQAALAPATSWPLSSFVPSQKTYPGNYGFRLGFLHSGTAKSVTCTYSPSLNK
LFCQLAKTCPVQLWVDSPPPPGTRVRAMAIYKKLEHMTEVVRRSPHHERSSDYSDGLAPP
QHLIRVEGNLRAEYFDDRNTFRHSVVVPYESPEIESECTTIHYNFMCNSSCMGGMNRRPI
LTIITLEDSRGNLLGRSSFEVRVCACPGRDRRTEEENFRKKGQSCPEPPPGSTKRALPSS
TSSSPQQKKKPLDGEYFTLQIRGRKRFEMFRELNEALELMDAQAGREPGESRAHSSHLKS
KKGPSPSCHKKPMLKREGPDSD
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggaagaatcgcaggcagaactcggtgtggagccccctctgagtcaggagacattttcc
gacttgtggaacctacttcctgaaaacaaccttctgtcctccgagctctccgcacctgtg
gatgacctgctcccgtactcagaagatgttgtcacctggctggatgagtgtccgaatgaa
gcgccccaaatgccagagcctcctgcccaagctgccctggcaccagccacctcctggccc
ctgtcgtcctttgtcccctcccagaagacctaccctggcaactacggtttccgtctcggg
ttcctgcattccggaacagccaagtctgtgacctgcacgtattccccttccctcaacaag
ctgttctgccagctggccaagacctgcccagtgcagctatgggtcgactcgccgcccccg
cccggcacccgcgtccgcgccatggccatctacaagaagctggagcacatgacggaggtt
gtgaggcgcagtccccaccatgagcgctcctctgactatagcgatggtctggccccgcct
cagcaccttatccgggtggaagggaatttacgcgcggagtatttcgacgaccggaacacc
tttagacacagtgtggtggtgccctatgagtcccccgagatcgagtctgagtgcaccacc
atccactacaacttcatgtgtaacagctcctgcatggggggcatgaaccggcggcccatc
ctcaccatcatcacactggaagactctcgtggtaacctgctgggacggagcagctttgag
gtgcgtgtttgtgcctgtcctgggagagaccgccgcactgaggaagaaaattttcgcaag
aaggggcagtcttgccccgagccaccccctgggagcactaagcgagcactgcccagcagc
accagctcctctccacagcaaaagaagaaaccactggatggagaatatttcactcttcag
atccgtgggcgtaaacgctttgagatgttccgagagctgaatgaggccttggagctgatg
gatgctcaggctggaagggaaccaggggaaagcagggctcattctagccacctgaagtct
aagaaggggccttctccctcctgccataaaaaaccaatgctcaagagagaagggcctgac
tcagactga

DBGET integrated database retrieval system