KEGG   Ovis aries (sheep): 443438
Entry
443438            CDS       T03117                                 

Gene name
IL3
Definition
(RefSeq) interleukin-3 precursor
  KO
K04736  interleukin 3
Organism
oas  Ovis aries (sheep)
Pathway
oas04060  Cytokine-cytokine receptor interaction
oas04151  PI3K-Akt signaling pathway
oas04210  Apoptosis
oas04630  JAK-STAT signaling pathway
oas04640  Hematopoietic cell lineage
oas04664  Fc epsilon RI signaling pathway
oas05200  Pathways in cancer
oas05202  Transcriptional misregulation in cancer
oas05221  Acute myeloid leukemia
oas05310  Asthma
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    443438 (IL3)
   04151 PI3K-Akt signaling pathway
    443438 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    443438 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    443438 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    443438 (IL3)
   04664 Fc epsilon RI signaling pathway
    443438 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    443438 (IL3)
   05202 Transcriptional misregulation in cancer
    443438 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    443438 (IL3)
  09163 Immune disease
   05310 Asthma
    443438 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oas04052]
    443438 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:oas00536]
    443438 (IL3)
Cytokines and growth factors [BR:oas04052]
 Cytokines
  Interleukins
   443438 (IL3)
Glycosaminoglycan binding proteins [BR:oas00536]
 Heparan sulfate / Haparin
  Cytokines
   443438 (IL3)
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 443438
NCBI-ProteinID: NP_001009420
Ensembl: ENSOARG00000015525
UniProt: Q06435
LinkDB
Position
5
AA seq 146 aa
MSSLSILHLLLLLLSLHAPQAQGLPLRTPRTPYSSLMEEIMDDLKKITPSPEGSLNSDEK
NILANKSLLQANLKAFMTFATDTFGSDSKIMKNLKEFQPVLPTATPTEDSILIEDSNLGD
FRMKLEEYLATIRGYLRHDLAAAETI
NT seq 441 nt   +upstreamnt  +downstreamnt
atgagcagcctctctatcttgcatctgctcctgctcctgctttctctccatgcccctcag
gcacaggggctgcctttgaggacaccgaggactccatattctagcttgatggaggaaatt
atggatgacctaaagaaaataactccgagtccagaaggctccttgaactcagatgagaag
aatatcctggcgaataagagcctcctacaggcaaacctgaaagcgttcatgacatttgcc
acagatacttttggaagtgattcaaaaatcatgaaaaatcttaaggaattccagccagtg
ctgcccacagccacacccacggaagattcaattcttattgaggacagcaacttgggggat
tttcggatgaaattggaagaatatttggctaccattagaggctatctcagacacgactta
gcagcagcagagactatctga

DBGET integrated database retrieval system