KEGG   Ovis aries (sheep): 443447
Entry
443447            CDS       T03117                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
oas  Ovis aries (sheep)
Pathway
oas04010  MAPK signaling pathway
oas04012  ErbB signaling pathway
oas04110  Cell cycle
oas04151  PI3K-Akt signaling pathway
oas04218  Cellular senescence
oas04310  Wnt signaling pathway
oas04350  TGF-beta signaling pathway
oas04390  Hippo signaling pathway
oas04550  Signaling pathways regulating pluripotency of stem cells
oas04630  JAK-STAT signaling pathway
oas04919  Thyroid hormone signaling pathway
oas05132  Salmonella infection
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05163  Human cytomegalovirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05169  Epstein-Barr virus infection
oas05200  Pathways in cancer
oas05202  Transcriptional misregulation in cancer
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05210  Colorectal cancer
oas05213  Endometrial cancer
oas05216  Thyroid cancer
oas05219  Bladder cancer
oas05220  Chronic myeloid leukemia
oas05221  Acute myeloid leukemia
oas05222  Small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    443447 (MYC)
   04012 ErbB signaling pathway
    443447 (MYC)
   04310 Wnt signaling pathway
    443447 (MYC)
   04350 TGF-beta signaling pathway
    443447 (MYC)
   04390 Hippo signaling pathway
    443447 (MYC)
   04630 JAK-STAT signaling pathway
    443447 (MYC)
   04151 PI3K-Akt signaling pathway
    443447 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    443447 (MYC)
   04218 Cellular senescence
    443447 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    443447 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    443447 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    443447 (MYC)
   05202 Transcriptional misregulation in cancer
    443447 (MYC)
   05206 MicroRNAs in cancer
    443447 (MYC)
   05205 Proteoglycans in cancer
    443447 (MYC)
   05230 Central carbon metabolism in cancer
    443447 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    443447 (MYC)
   05225 Hepatocellular carcinoma
    443447 (MYC)
   05226 Gastric cancer
    443447 (MYC)
   05216 Thyroid cancer
    443447 (MYC)
   05221 Acute myeloid leukemia
    443447 (MYC)
   05220 Chronic myeloid leukemia
    443447 (MYC)
   05219 Bladder cancer
    443447 (MYC)
   05213 Endometrial cancer
    443447 (MYC)
   05224 Breast cancer
    443447 (MYC)
   05222 Small cell lung cancer
    443447 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    443447 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    443447 (MYC)
   05161 Hepatitis B
    443447 (MYC)
   05160 Hepatitis C
    443447 (MYC)
   05163 Human cytomegalovirus infection
    443447 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    443447 (MYC)
   05169 Epstein-Barr virus infection
    443447 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    443447 (MYC)
   03019 Messenger RNA biogenesis [BR:oas03019]
    443447 (MYC)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    443447 (MYC)
Messenger RNA biogenesis [BR:oas03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     443447 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 443447
NCBI-ProteinID: NP_001009426
UniProt: Q28566
LinkDB
Position
9
AA seq 439 aa
MPLNVSFANRNYDLDYDSVQPYFYCDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVASFSPRGDDDGGGGSFSSADRLEMVTELLGGDMVNQSFICDPD
DETLIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDGGSPSPARGHGGCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKPCASPDSTAFSPSSDSLLSSAESSPRASPEPLAL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQPPAKRSESGSPSAGSHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCASPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEKDVL
RKRREQLKLKLEQIRNSCA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcccctcaacgtcagcttcgccaacagaaactatgacctcgactacgattcggtgcag
ccttatttctactgcgacgaggaggagaacttctaccaccagcagcagcagagcgaactg
cagccgccggcgcccagcgaggacatctggaagaaattcgagctgctgcccaccccgccc
ctgtcccctagccgccgctccgggctctgctcgccgtcgtacgtcgcggtcgcctccttc
tcgcccaggggagacgacgacggcggcggcggcagcttttcctccgcggaccggttggag
atggtgaccgagctgctgggaggcgacatggtgaaccagagcttcatctgcgaccccgac
gatgagaccctcatcaaaaacatcatcatccaggactgtatgtggagcggcttctcggcc
gccgccaagctcgtctcggagaagctggcctcttaccaggctgcgcgcaaagacggcggc
agcccgagccccgcccgcgggcacggcggctgctccacctccagcttgtacctgcaggac
ctgagcgccgccgcctctgaatgcatcgacccctcggtggtcttcccctacccgctcaac
gacagcagctcgcccaagccctgcgcctccccggactccaccgccttctccccctcctct
gactctctgctctcctctgctgagtcctccccgcgggccagtcccgagcccctggctctc
cacgaggagaccccacccacgaccagcagcgactctgaggaagaacaagaggatgaggaa
gaaattgatgttgtctctgtggaaaagaggcaaccccctgccaaaaggtcagaatcgggg
tcaccctctgccggcagccacagcaaacctcctcacagcccgttggtcctaaagagatgc
cacgtgtctacgcatcagcacaattacgcagcgcccccctccactaggaaggactatccc
gccgccaagagggctaagttggacagtggcagggtcctgaaacagatcagcaacaaccgc
aaatgtgccagcccgaggtcttcggacacggaggagaatgacaagaggcggacacacaac
gttttggagcgccagaggagaaacgagctgaaacgcagcttttttgctcttcgtgaccag
atcccagagttggagaacaatgaaaaagcccccaaagtagttatccttaaaaaagccaca
gcatacatcctgtcggtccaagcagaggagcaaaagctcatttcagaaaaagacgtgttg
cggaagaggcgagaacagttgaaactcaaacttgaacagatacggaactcttgcgcctaa

DBGET integrated database retrieval system