KEGG   Ovis aries (sheep): 443489Help
Entry
443489            CDS       T03117                                 

Gene name
PFKM
Definition
(RefSeq) LOW QUALITY PROTEIN: ATP-dependent 6-phosphofructokinase, muscle type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
oas  Ovis aries (sheep)
Pathway
oas00010  Glycolysis / Gluconeogenesis
oas00030  Pentose phosphate pathway
oas00051  Fructose and mannose metabolism
oas00052  Galactose metabolism
oas01100  Metabolic pathways
oas01200  Carbon metabolism
oas01230  Biosynthesis of amino acids
oas03018  RNA degradation
oas04152  AMPK signaling pathway
oas05230  Central carbon metabolism in cancer
Module
oas_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    443489 (PFKM)
   00030 Pentose phosphate pathway
    443489 (PFKM)
   00051 Fructose and mannose metabolism
    443489 (PFKM)
   00052 Galactose metabolism
    443489 (PFKM)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    443489 (PFKM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    443489 (PFKM)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    443489 (PFKM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oas01009]
    443489 (PFKM)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:oas03019]
    443489 (PFKM)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     443489 (PFKM)
Protein phosphatases and associated proteins [BR:oas01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     443489 (PFKM)
Messenger RNA biogenesis [BR:oas03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     443489 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK Phage_TAC_14
Motif
Other DBs
NCBI-GeneID: 443489
NCBI-ProteinID: XP_004006455
Ensembl: ENSOARG00000019300
LinkDB All DBs
Position
3
AA seq 849 aa AA seqDB search
MRKVEFHLKFFMCVTQSRQLVRTPQRTAEEASTSSMLIQKPPSGTDALESLDTVDDPDTV
EGIPIIENEWIMTHEEHHEAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIYTGARVF
FVHEGYQGLVDGGDNIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRG
ITNLCVIGGDGSLTGADTFRSEWGDLLSDLQKSGKITAEEATKSSYLNIVGLVGSIDNDF
CGTDMTIGTDSALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVF
IPECPPDDDWEEHLCRRLSETRNRGSRLNIIIVAEGAIDKQGKPITSEDIKNLVVKRLGY
DTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLM
ECVQVTKDVTRAMDERRFDEAMKLRGRSFMNNWEVYKLLAHVRPPKSKSGLHTVAVXGAP
AAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKR
TLPKKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQYDELCIPFVVIPATVSN
NVPGSDFSVGADTALNTICMTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGAD
AAYIFEEPFTIRDLQVNVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGI
FDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVL
GMRKRALLFQPVTELQEQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSEHAHLEHIT
RKRSGEANI
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaagtggaatttcatctgaaatttttcatgtgtgtaactcagtctcgccagtta
gtcaggactcctcagagaacagctgaagaagcttcaacttccagcatgctcatacaaaag
ccaccgtctgggacagatgccttggagagtctagataccgtggatgatccagacactgtg
gaaggcatacccattattgaaaatgagtggatcatgacccatgaagagcaccatgaagcc
aaaaccctgggaatcggcaaagccatcgccgtgttaacctctggtggcgatgcccaaggt
atgaatgctgctgtcagggctgtggttcgtgttggcatctatactggtgcccgtgtcttc
tttgtccatgagggttatcaaggcctggtagatggtggagataacatccgggaagccaca
tgggagagcgtctcgatgatgcttcagctgggaggcacagtgattggaagcgcccggtgc
aaggactttcgggagcgggaaggccggctccgagctgcccacaacctggtgaagcgtggg
atcaccaacctgtgtgtcattgggggagacggcagcctcactggggccgacaccttccgc
tctgagtggggtgacttgttgagtgacctccagaaatcaggcaagatcacagcagaggag
gctaccaagtccagctacctgaacatcgtgggcctggttggctcaattgacaatgacttc
tgtggcactgatatgaccattggcaccgactctgccctgcaccggatcatagagattgta
gatgccatcactactaccgctcagagccaccagaggacctttgtgttggaggtgatgggc
cggcactgtgggtacctggcccttgtcacgtccctctcctgtggggccgactgggtcttc
attcccgagtgtccaccagatgacgactgggaggaacacctttgtcgtcggctcagtgag
acaaggaaccgtggttctcgtctcaacatcatcatcgtagctgagggtgcaattgacaag
caggggaaaccaatcacctctgaagacataaaaaatctggtggttaagcgtctgggatat
gacacccgggtcactgtcttggggcatgtgcagcggggtgggacaccgtcagcctttgac
aggatcctgggcagcaggatgggtgtggaagcagtaatggcgcttttggaggggaccccg
gacaccccagcctgtgtggtgagcctctctggtaaccaggctgtgcgcctgcccctcatg
gagtgtgtgcaggtgaccaaggacgtgaccagggccatggatgagaggagattcgatgaa
gccatgaagttgaggggccggagcttcatgaacaactgggaggtatacaagcttctggct
cacgtcagacccccaaagtctaagagtggcttgcacacggtggccgttnngggcgcgccg
gctgcgggcatgaatgccgctgttcgctccactgtgagaattggcctcatccagggcaac
cgagtgctggtggtgcacgatggcttcgagggcctggccaagggccagatcgaggaagct
ggatggagctacgttgggggctggactggccaaggtggttctaaacttgggactaaaagg
actctaccaaagaagagctttgaacagatcagtgccaacatcacgaagtttaatattcag
ggccttgtcatcatcgggggctttgaggcgtacacgggaggcctggagctgatggagggc
aggaagcagtacgatgagctctgcatccccttcgtggtcatccctgccacggtctccaac
aacgtgcccggctcggacttcagcgtgggggctgacactgccctcaacactatctgcatg
acgtgtgaccgcatcaagcagtcagcggcaggcaccaagcgccgtgtgtttatcattgaa
acgatgggcggctactgtggctacctggccaccatggcaggcctggcagccggggctgat
gctgcgtatatttttgaggagcccttcaccattcgagacctgcaggtgaatgtggagcat
ctggtgcaaaagatgaaaacaactgtgaagaggggcctggtgttaaggaatgagaagtgc
aatgagaactacaccactgacttcatcttcaacctgtactctgaggaggggaagggcatc
ttcgacagcaggaagaacgtgctgggccacatgcagcagggtgggagcccaactccattc
gataggaattttgccactaagatgggtgcaaaggctatgaactggatgtcagggaaaatc
aaagagagttaccgtaacgggcggatctttgccaataccccagactcgggctgtgttctg
gggatgcgtaagagggccctgctcttccaaccagtgactgagttgcaggaacagacggat
tttgagcaccgcatccccaaggagcagtggtggctgaagctgaggcccatcctcaagatc
ctcgccaagtacgagattgacctggatacctcagagcacgcccacctggagcacatcact
cggaagcggtccggagaagctaacatctag

DBGET integrated database retrieval system