KEGG   Ovis aries (sheep): 443551Help
Entry
443551            CDS       T03117                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin G/H synthase 1 precursor
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas00590  Arachidonic acid metabolism
oas01100  Metabolic pathways
oas04611  Platelet activation
oas04726  Serotonergic synapse
oas04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    443551 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    443551 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    443551 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    443551 (PTGS1)
Enzymes [BR:oas01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     443551 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF EGF_2
Motif
Other DBs
NCBI-GeneID: 443551
NCBI-ProteinID: NP_001009476
Ensembl: ENSOARG00000014116
UniProt: P05979
LinkDB All DBs
Structure
PDB: 

Position
3
AA seq 600 aa AA seqDB search
MSRQSISLRFPLLLLLLSPSPVFSADPGAPAPVNPCCYYPCQHQGICVRFGLDRYQCDCT
RTGYSGPNCTIPEIWTWLRTTLRPSPSFIHFLLTHGRWLWDFVNATFIRDTLMRLVLTVR
SNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMDTKGKKQLPDAEFLSRR
FLLRRKFIPDPQSTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLER
QYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLML
YATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLK
FDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVE
ALVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRVLRLQPFNEYRKRFGMKPYTSFQE
LTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPIC
SPEYWKASTFGGEVGFNLVKTATLKKLVCLNTKTCPYVSFHVPDPRQEDRPGVERPPTEL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcagagtatctcgctccgattcccgctgcttctcctgctgctgtcgccatcc
cccgtcttctcagcggaccccggggcgcccgcgccagtgaacccctgctgttactatcca
tgccagcaccaggggatctgtgttcgcttcggccttgaccgctaccaatgtgactgcacc
cgcacgggctattccggccccaactgcaccatcccggagatatggacctggctccggacg
actttgcggcccagcccctctttcatccactttctgctgacgcacgggcgctggctttgg
gattttgtcaatgccaccttcatccgggacacgctcatgcgtctggtactcacagtgcgt
tccaaccttatccccagccctcccacctacaacatagcgcacgattacatcagctgggag
tccttctccaatgtgagctattatactcgcattctgccctccgtgccccgagactgtccc
acgcccatggacaccaaagggaagaagcaattgccagatgcggagttcctgagccgtcgc
ttcctgctcaggaggaagttcatccctgaccctcaaagcaccaacctcatgtttgccttc
tttgcccaacacttcacccatcagttcttcaaaacttccggcaagatgggtcctggcttc
accaaggcgctgggccacggggtagacctcggccacatttatggagacaatctggaacgt
cagtatcagctgcggctctttaaggatgggaagctgaagtaccagatgctcaatggagag
gtgtacccgccatcggtggaagaggcgcccgtgctgatgcactacccccggggcatcccg
ccccagagccagatggctgtgggccaggaggtgtttgggctgcttcctggactcatgctc
tacgccacgatctggctgcgtgagcacaaccgcgtgtgtgacctgctgaaggctgagcac
cccacctggggcgacgagcagctcttccagacggcccgcctcatcctcatcggggagacc
atcaagattgtgatagaggagtatgtgcagcagctgagcggctacttcctgcagctcaag
ttcgacccagagctgctgttcggggcccagttccagtaccgcaaccgcatcgccatggag
ttcaaccagctgtaccactggcacccgctcatgcccgactccttccgggtgggcccccag
gactacagctacgagcagtttctgttcaacacctccatgctggtggactacggggtcgag
gccctggtggacgccttttctcgccagcctgcaggccggattggtgggggtaggaacata
gaccaccacatcctgcacgtggccgtggatgtcatcaaggaatcacgggtgctaaggctg
cagcccttcaatgagtaccgcaagaggtttggcatgaagccctacacctctttccaagag
ctcacaggtgagaaggagatggcagctgaattggaggagctgtatggagacattgatgct
ttggaattctacccggggctacttcttgagaagtgccatccgaactccatctttggggag
agtatgatagaaatgggggctcctttttcccttaagggcctcttaggaaaccccatctgt
tctccagagtactggaaggcgagcacatttggcggtgaggtgggcttcaaccttgtcaag
acggccacgctaaagaagctggtttgcctcaacaccaagacttgtccctatgtctccttc
cacgtaccagacccccgtcaggaggacaggcctggggtggagcggccacccacagagctc
tga

DBGET integrated database retrieval system