KEGG   Ovis aries (sheep): 554324
Entry
554324            CDS       T03117                                 

Gene name
FGFR3
Definition
(RefSeq) fibroblast growth factor receptor 3 isoform X1
  KO
K05094  fibroblast growth factor receptor 3 [EC:2.7.10.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas04010  MAPK signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04020  Calcium signaling pathway
oas04144  Endocytosis
oas04151  PI3K-Akt signaling pathway
oas04550  Signaling pathways regulating pluripotency of stem cells
oas04810  Regulation of actin cytoskeleton
oas05200  Pathways in cancer
oas05206  MicroRNAs in cancer
oas05219  Bladder cancer
oas05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    554324 (FGFR3)
   04014 Ras signaling pathway
    554324 (FGFR3)
   04015 Rap1 signaling pathway
    554324 (FGFR3)
   04020 Calcium signaling pathway
    554324 (FGFR3)
   04151 PI3K-Akt signaling pathway
    554324 (FGFR3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    554324 (FGFR3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    554324 (FGFR3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    554324 (FGFR3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    554324 (FGFR3)
   05206 MicroRNAs in cancer
    554324 (FGFR3)
   05230 Central carbon metabolism in cancer
    554324 (FGFR3)
  09162 Cancer: specific types
   05219 Bladder cancer
    554324 (FGFR3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    554324 (FGFR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    554324 (FGFR3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:oas04090]
    554324 (FGFR3)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     554324 (FGFR3)
Protein kinases [BR:oas01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   554324 (FGFR3)
CD molecules [BR:oas04090]
 Proteins
  554324 (FGFR3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig V-set FGFR3_TM C2-set_2 Pkinase_fungal
Other DBs
NCBI-GeneID: 554324
NCBI-ProteinID: XP_027827116
UniProt: A0A6P7EA71
LinkDB
Position
6
AA seq 803 aa
MGAPARALAFCVAVAVMSGAVLGSPGLEPRVARRAAEAPGPEPSPQERAFGSGDTVELSC
RSPAGVPTEPTIWVKDGVGLAPSDRVLVGPQRLQVLNASHEDAGAYSCRQRLSQRLLCLF
SVRVTDAPSSGDDEDGDDEAEDAAGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTP
SITWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGRIQQTYTLD
VLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTP
YVTVLKSWISESAEADARLRLANVSERDGGEYLCRASNFIGVAEKAFWLRVHGPPAAEEE
LVEAGEAGSVFAGVLSYGLGFLLFILAVAAVTLYRLRSPPKKGLGSPAVHKVSRFPLKRQ
VSLESSSSMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGC
FGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLL
GACTQGGPLYVLVEYAAKGNLREYLRARRPPGTDYSFDTCRLPEEQLTFKDLVSCAYQVA
RGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMA
PEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHD
LYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSVPFEQYSPGGQDTPSSGS
SGDDSVFAHDLLPPAPGSGGSRT
NT seq 2412 nt   +upstreamnt  +downstreamnt
atgggcgccccggctcgcgccctcgcgttttgcgtggcagtggcggtcatgagcggcgcc
gtcctcgggtccccgggcctggagccccgcgttgcacggagagcggcagaggccccaggc
cccgagcccagcccacaggagcgggcctttggcagcggggacaccgtggagctgagctgc
cgctcgccggcgggggtgcccacagaacccaccatctgggtgaaggacggcgtgggcctg
gcgccctcggaccgcgtcctggtggggccacagcggctacaggtgctcaacgcctcccac
gaggacgccggggcctacagctgccgccagcgcctctcccagcggctgctgtgcctcttc
agcgtgcgcgtgacagacgctccgtcctcgggggatgatgaagatggggacgacgaggct
gaggacgcagcaggggccccttactggacgcggcccgagcggatggacaagaagctgcta
gcggtgccggccgccaacacggttcgcttccgctgcccggctgccggcaaccccacgcca
tccatcacctggctgaagaacggcaaggagttccggggcgagcaccgcatcggagggatc
aagctgcggcaccagcagtggagcctggtcatggagagcgtggtgccctcggaccgcggc
aactacacgtgcgtcgtggagaacaagtttggcagaatccagcagacctacaccctggac
gtgctggagcgctctccgcaccggcccatcctccaggcggggctgcccgccaaccagacc
gccgtgctgggcagcgacgtggagttccactgcaaggtgtacagcgatgcccagccccac
atccagtggctcaagcacgtggaggtgaacggcagcaaggtggggcccgacggcacgccc
tacgtcaccgtgctcaagtcgtggatcagtgagagtgcggaggccgacgcgcgcctccgc
ctggccaatgtgtccgagcgtgacgggggcgagtacctctgtcgagcctccaatttcata
ggcgtggctgagaaggccttttggctgcgtgttcacgggcccccagcagccgaggaggag
ctggtggaagctggtgaggctggcagtgtgttcgcgggcgtcctcagctacgggctgggc
ttcctcctcttcatcctggctgtggccgccgttacgctctaccgcctgcggagccccccc
aagaagggcctgggctcgcccgcggtgcacaaggtctcccgcttcccgctcaagcgacag
gtgtccttggagtccagttcatccatgagctccaacacgccactggtacgcatcgcccgg
ctgtcctcgggcgagggccccaccctggccaacgtctctgagctcgagctgcccgccgac
cccaagtgggagctgtcccgggcccggctgaccctgggcaagcctcttggggagggctgc
ttcggccaggtggtcatggcagaggccattggcatcgacaaggaccgagctgccaagccc
gtcacggtggcggtgaagatgctgaaagatgacgccacggacaaggacttgtcggacctg
gtgtccgagatggagatgatgaagatgatcggaaaacataagaacattatcaacttgcta
ggcgcctgcacgcagggcgggcccctgtacgtgctggtggagtacgcggccaagggcaac
ctacgggagtacctgcgggcgcggcggcccccaggcactgactactccttcgacacctgc
cggctgcccgaggagcagctcaccttcaaagacctggtgtcctgcgcctaccaggtggcg
cggggcatggagtacctggcctcgcagaagtgcatccatagggacctggcggcccgcaac
gtgctggtgaccgaggacaacgtgatgaaaatcgccgacttcggcctggcccgtgatgtg
cacaacctcgactactacaagaagacaacaaacggccgcctgcccgtgaagtggatggca
cccgaggccttgtttgaccgcgtctacacccaccaaagtgatgtgtggtccttcggggtc
ctgctctgggagatcttcacgctggggggctcgccgtaccctggcatccccgtggaggag
ctcttcaagctgctgaaggaaggccaccgcatggacaagccggccaactgcacgcatgac
ctgtacatgatcatgcgtgagtgctggcacgccgcgccctcgcagaggcccaccttcaag
cagctggtggaggacctggaccgtgtgctcactgtgacttccactgacgagtacctggac
ctgtcagtgcccttcgagcagtactcaccgggcggccaggacacccccagctccggctcc
tctggggacgactccgtgttcgctcacgacctgctgcccccggcccctggtagcggaggc
tctcggacgtga

DBGET integrated database retrieval system