KEGG   Ovis aries (sheep): 554335Help
Entry
554335            CDS       T03117                                 

Gene name
ACE
Definition
(RefSeq) angiotensin-converting enzyme isoform X1
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas04614  Renin-angiotensin system
oas04924  Renin secretion
oas05142  Chagas disease (American trypanosomiasis)
oas05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:oas00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    554335 (ACE)
   04614 Renin-angiotensin system
    554335 (ACE)
 09160 Human Diseases
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    554335 (ACE)
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    554335 (ACE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:oas01002]
    554335 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oas04147]
    554335 (ACE)
   04090 CD Molecules [BR:oas04090]
    554335 (ACE)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     554335 (ACE)
Peptidases [BR:oas01002]
 Metallo Peptidases
  Family M2
   554335 (ACE)
Exosome [BR:oas04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   554335 (ACE)
CD molecules [BR:oas04090]
 Proteins
  554335 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 554335
NCBI-ProteinID: XP_012041693
Ensembl: ENSOARG00000012958
LinkDB All DBs
Position
11
AA seq 1100 aa AA seqDB search
MASPVYPLVPSWCPQEEAALLSQEFSEAWGQKAKGLFDPVWQNFTDPTLLRIIGAVRTLG
PANLDLEKRQKYNSLLSNMSRIYSTAKVCFPNKTAPCWSLDPELTNVLASSRSYALLLYA
WEGWHNAAGIPLKPLYQDFTALSNEAYKQDGFSDTGAYWRSWYDSPTFTEDLERLYQQLE
PLYLNLHAYVRRALHRRYGDRYINLRGPIPAHLLGNMWAQSWENVYDMVVPFPDKPNLDV
TSAMVQKGWNATHMFRVAEEFFTSLGLLPMPPEFWAESMLEKPSDGREVVCHASAWDFYN
RKDFRIKQCTRVTMDQLSTVHHEMGHVQYYLQYKDQHVSLRRGANPGFHEAIGDVLALSV
STPAHLHKIGLLDQVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVFSGRTPPSRY
NYDWWYLRTKYQGICPPVVRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQFHEALCKEA
GHQGPLHQCDIYQSTQAGAKLRALLQAGSSRPWQEVLKDMVGSDNLDARPLLSYFQPVTQ
WLEEQNQQNGEVLGWPEYQWRPPTPDNYPEGIDLVSDEAEARKFVEEYDRRSQVVWNEYA
EANWNYNTNISTDNSKLLMQKNLQMANHTVKYGTWARRFDVTNFQNATMKRMIKKIQDLE
RAALPVKELEEYNQILVDMETVYSVASVCHKNGTCLRLEPDLTRLMATSRNYQDLAWAWK
SWRDKVGRSILPYFPKYVELTNKAARLNGYQDGGDSWRSMYEMPFLEEELEQLFQELQPL
YLNLHAYVRRALHHHYGPDVINLEGPIPAHLLGNMWAQSWSNIYDLVAPFPSAPKMDATE
AMIKQGWTPLRMFKEADNFFTSLGLLPMPPEFWNKSMLEKPTDGREVVCHASAWDFFNGK
DFRIKQCTSVNMEDLVVAHHEMGHIQYFMQYKDLPVTFREGANPGFHEAIGDVLALSVST
PTHLHKIGLLSSGDGSYEEDINFLMKMALDKIAFIPFSFLVDQWRWRVFDGSVTRENYNQ
EWWSLRLKYQGVCPPLARSQDDFDPGAKFHIPASVPYVRYFVSFVIQFQFHQALCQAAGH
QGPLHKCDIYQSKEAGKLLA
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccctgtttaccctctcgtgccctcctggtgcccacaggaggaagcagccttg
ctcagccaggagttttcagaggcctggggccagaaggccaagggtctgtttgacccggtc
tggcagaactttaccgaccccacgctgctgcgcatcatcggggcggtgcgcaccttgggc
cccgccaacctggacctagagaagcggcagaagtacaactctctgctaagcaacatgagc
aggatttactccaccgccaaggtctgcttccccaacaagactgccccctgctggtccctg
gacccagagctcaccaacgtcctggcttcctcacgaagctacgccctgctgctgtatgcc
tgggagggctggcacaacgctgcgggcatcccactgaagcccctataccaggacttcact
gccctcagcaacgaggcctacaagcaggatggcttctcagacacaggggcctactggcgc
tcctggtacgactctcccaccttcacggaggatctggaacgcctctaccagcagctggag
cccctctacctgaacctccatgcctacgtccggcgtgcactgcaccgccgatatggggac
agatacatcaacctcaggggacccatccccgctcacctgctggggaacatgtgggcccag
agctgggagaatgtctacgacatggtggtgcccttccccgacaagcccaatcttgatgtt
accagtgctatggtgcagaagggctggaacgccacacacatgttccgggtggcggaggag
ttcttcacctccctggggctcttgcccatgccacccgagttctgggcggaatccatgctg
gagaagccaagcgacgggcgggaggtggtgtgccacgcgtccgcctgggacttctacaac
aggaaagacttcaggatcaagcagtgcacacgggtcactatggaccagctgtccacggtg
caccacgagatgggccacgtgcagtactacctgcagtacaaggaccagcacgtctccctg
cgccgaggcgccaacccaggcttccacgaggccatcggcgatgtgctggccctctccgtc
tccactcctgcacacctgcacaagatcggcctgctggaccaggtcaccaacgacacagag
agcgacatcaactacttgttaaagatggcactggaaaaaattgccttcctgccctttggc
tacttggtggaccagtggcgttggggggtctttagtgggcgaacccccccttcccgctac
aactatgactggtggtatcttcgaaccaagtatcaggggatctgtcctccggttgtccga
aacgaaacccactttgacgctggagccaaatttcacgtcccaaatgtgaccccatatatc
aggtacttcgtgagctttgtcctgcagttccagttccacgaagcgctgtgcaaggaggca
ggccaccaaggccccctgcaccagtgtgacatctaccagtccacccaggcgggggccaag
ctccgggcgctgctgcaggcaggctcctcacggccctggcaggaggtgctgaaggacatg
gtcggctcagacaacctggacgctaggccgctgctcagctacttccagccggtcacacag
tggctcgaggagcagaaccagcagaacggcgaggtcctgggctggccagagtatcagtgg
cgcccgccgacgcctgacaattacccggagggcattgacctggtgtccgacgaggccgag
gcccgcaagtttgtggaggaatatgaccggagatcccaggtggtgtggaatgagtatgcc
gaggccaactggaactacaacaccaacatcagcacggacaacagcaagttgctgatgcag
aagaacttacagatggcaaaccacaccgtcaagtatggcacctgggccaggaggttcgac
gtgaccaacttccagaatgccaccatgaagcggatgataaagaagattcaggatctagaa
cgggcggcactgcccgtcaaggagctggaggagtacaaccagatcctggtggacatggag
accgtttacagcgtggcttctgtgtgccacaaaaatggcacctgcctgcggctcgagcct
gatctgaccaggctgatggccacatcccggaattatcaggacctggcctgggcgtggaag
agctggcgcgacaaggtggggcggtccattctcccctacttccctaaatatgtggagctc
accaacaaggccgccaggctcaatggctaccaggatggcggggactcctggaggtccatg
tacgagatgcccttcctagaggaggagctggagcagctgttccaagagctgcagccgctc
tacctgaacctgcatgcctatgtgcgccgggccctgcaccaccactacgggcccgacgtc
atcaacctggagggccccatcccagcccacctgctcgggaacatgtgggcacagagctgg
tccaacatctatgacttggtggcacccttcccttcagcccccaagatggatgccacggag
gccatgataaagcagggctggacacccctaaggatgtttaaggaagcagacaatttcttc
acttccctggggctgctgcccatgccccccgagttctggaacaagtcgatgctggagaag
ccgactgatgggcgggaagtggtgtgccatgcctccgcctgggacttcttcaacggcaag
gactttaggatcaagcagtgcacctcagtgaacatggaagacctggtggtggcccaccac
gaaatgggccacatacagtacttcatgcagtacaaggacttgcccgtgaccttccgggag
ggcgccaaccccggctttcacgaggccattggggacgtgctggccctctcagtgtccacc
cccacgcacctgcacaagatcggcctgctgagcagcggggacggcagctacgaggaggat
atcaactttctgatgaagatggcgcttgacaagatcgccttcatccccttcagcttcctc
gtcgaccagtggcgctggagggtgtttgacggaagtgtcaccagggagaactacaaccag
gagtggtggagcctcaggctgaagtaccagggtgtctgtcccccgctggccagatctcaa
gacgactttgacccaggggccaagttccacattcctgcaagtgtgccttatgtcaggtac
ttcgtcagcttcgtcatccagttccagttccaccaggcactgtgtcaggcggcgggccac
cagggccccctgcacaagtgtgacatctaccagtccaaggaggccgggaagctcctggcg
tga

DBGET integrated database retrieval system