KEGG   Ovis aries (sheep): 780444
Entry
780444            CDS       T03117                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas01524  Platinum drug resistance
oas04012  ErbB signaling pathway
oas04014  Ras signaling pathway
oas04022  cGMP-PKG signaling pathway
oas04024  cAMP signaling pathway
oas04062  Chemokine signaling pathway
oas04140  Autophagy - animal
oas04151  PI3K-Akt signaling pathway
oas04210  Apoptosis
oas04370  VEGF signaling pathway
oas04510  Focal adhesion
oas04722  Neurotrophin signaling pathway
oas04910  Insulin signaling pathway
oas04919  Thyroid hormone signaling pathway
oas05010  Alzheimer disease
oas05014  Amyotrophic lateral sclerosis
oas05020  Prion disease
oas05022  Pathways of neurodegeneration - multiple diseases
oas05145  Toxoplasmosis
oas05152  Tuberculosis
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05162  Measles
oas05165  Human papillomavirus infection
oas05168  Herpes simplex virus 1 infection
oas05170  Human immunodeficiency virus 1 infection
oas05200  Pathways in cancer
oas05203  Viral carcinogenesis
oas05210  Colorectal cancer
oas05211  Renal cell carcinoma
oas05212  Pancreatic cancer
oas05213  Endometrial cancer
oas05215  Prostate cancer
oas05218  Melanoma
oas05220  Chronic myeloid leukemia
oas05221  Acute myeloid leukemia
oas05223  Non-small cell lung cancer
oas05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    780444 (BAD)
   04014 Ras signaling pathway
    780444 (BAD)
   04370 VEGF signaling pathway
    780444 (BAD)
   04024 cAMP signaling pathway
    780444 (BAD)
   04022 cGMP-PKG signaling pathway
    780444 (BAD)
   04151 PI3K-Akt signaling pathway
    780444 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    780444 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    780444 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    780444 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    780444 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    780444 (BAD)
   04919 Thyroid hormone signaling pathway
    780444 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    780444 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    780444 (BAD)
   05203 Viral carcinogenesis
    780444 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    780444 (BAD)
   05212 Pancreatic cancer
    780444 (BAD)
   05225 Hepatocellular carcinoma
    780444 (BAD)
   05221 Acute myeloid leukemia
    780444 (BAD)
   05220 Chronic myeloid leukemia
    780444 (BAD)
   05218 Melanoma
    780444 (BAD)
   05211 Renal cell carcinoma
    780444 (BAD)
   05215 Prostate cancer
    780444 (BAD)
   05213 Endometrial cancer
    780444 (BAD)
   05223 Non-small cell lung cancer
    780444 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    780444 (BAD)
   05014 Amyotrophic lateral sclerosis
    780444 (BAD)
   05020 Prion disease
    780444 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    780444 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    780444 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    780444 (BAD)
   05161 Hepatitis B
    780444 (BAD)
   05160 Hepatitis C
    780444 (BAD)
   05162 Measles
    780444 (BAD)
   05168 Herpes simplex virus 1 infection
    780444 (BAD)
   05165 Human papillomavirus infection
    780444 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    780444 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    780444 (BAD)
   01524 Platinum drug resistance
    780444 (BAD)
   01522 Endocrine resistance
    780444 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 780444
NCBI-ProteinID: XP_004019699
Ensembl: ENSOARG00000006281
UniProt: A0A6P3EPN9
LinkDB
Position
21
AA seq 168 aa
MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSH
HGGTGAVETRSRHSSYPAGPEDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSD
EFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQSWLSRNLGRGGSAPSQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagcagagtgagcaggaagactccagccctgcagatagg
ggcctgggccccagccccacaggggacaggcccccaggtctcagcaagcactggctaaca
gccccgggcctcctgggggaagctggtcaccagcaggggcagccggccggcagcagccac
catggaggcactggggctgtggagacccggagtcgtcacagctcctaccccgcggggcca
gaggatgacgaagggacggaggaggaggatctcggcccctttaggggccgctcgcgttcg
gcgccccccaacctctgggctgcacagcgatacggccgcgagctccgaaggatgagcgac
gagtttcacgtctccttcaaggggcttcctcgcccgaagagcgcgggcacggcaacgcaa
atgcgacaaagccctagctggacgcgcttcctccagtcctggttgagccggaacttgggg
agaggaggctccgccccctctcagtga

DBGET integrated database retrieval system